DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wdr62 and Wdr43

DIOPT Version :9

Sequence 1:NP_001259886.1 Gene:Wdr62 / 33367 FlyBaseID:FBgn0031374 Length:2397 Species:Drosophila melanogaster
Sequence 2:NP_001032880.2 Gene:Wdr43 / 362703 RGDID:1565005 Length:674 Species:Rattus norvegicus


Alignment Length:814 Identity:138/814 - (16%)
Similarity:257/814 - (31%) Gaps:299/814 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   436 FVTCSSDDTIRVWGLDGCTNNDIYRRNIYSKEL----LKIVYSDDELQFIKDQGSSLFDKAGNSS 496
            |...|||..:|||   ...||.:::..:.|..|    ..:.::...||            |..|.
  Rat    29 FALASSDGHLRVW---ETANNRLHQEYVPSAHLSGTCTCLAWAPARLQ------------AKESH 78

  Fly   497 YDGRNGVRCIKISPELQHLASGDRCGNIRVYSLVNLRLLTTI--EAHESEVLCLEY--------- 550
            ...:.....|..:.:...||.|...|:|.:||.|...|.:.:  ..||..|.|:::         
  Rat    79 QRKKRKSEAIGTNDQADLLALGTAVGSILLYSTVKGELHSKLISGGHEKRVNCIQWHQDNDCLYS 143

  Fly   551 -SNEKI-----------------------------ERKLLASASRDRLIHVFDVAQNYLLLQTLD 585
             |::|.                             :.|:|.||.|...:.|.:..:.|   :...
  Rat   144 CSDDKYIVEWSTQMCRVKCKWKGDNSSVSSLCISPDGKMLLSAGRTIKLWVLETKEVY---RHFT 205

  Fly   586 DHSSSITSIKFVGAGLNFQMISCGADKSIMFRSFQGNIFMRGTNTSGKTTLYDMEVDSNAKHILT 650
            .|::.::|::|.         :...::|..|....|..|:.|                       
  Rat   206 GHATPVSSLRFT---------TIRPNESQPFDGVTGLYFLSG----------------------- 238

  Fly   651 ACQDR--NVRVYGTQNAKQTKTFKGSHSDEGSLIKLSLDPS---GIYVATSCTDKTLAVYDYYSN 710
            |..||  ||....::|.:::.....:.:||...|.|:|..:   .:.:|..|.|..:.::::..|
  Rat   239 AVHDRLLNVWQVRSENKEKSAVMSFTVTDEPVYIDLTLSENKEEPVKLAVVCRDGQVHLFEHVLN 303

  Fly   711 ECMARMYGHSELVTGLKFTNDCRHLISASGDGCIFIWQVPHDMIVTMQARMSQQRLRSGHAPLPR 775
                   ||.:    ...|::|...::..|                           .|....|:
  Rat   304 -------GHCK----KPLTSNCTIQVATPG---------------------------KGKKATPK 330

  Fly   776 PLAPISPPDGIVLE------------SPTSEIEQPQLQPK--FGVAERFSDVGQLPQWAMRKAAA 826
            |:..::.  |..|:            .||  ||:..|..|  ....||  |:...  |     |.
  Rat   331 PIPILAA--GFCLDKMSLLLVYGSWFQPT--IERLALNSKDTHICLER--DISNC--W-----AP 382

  Fly   827 DSDSGALSIPTPSGGSAT------VPGMHA--------------ASSMGNLSSSPSQQMTGLAPR 871
            ..::....:.||...|..      |||.||              ...:|...::..:::..:...
  Rat   383 TVETAITKVKTPVMNSEAKVLVPGVPGHHAPIKLLPAQPKEAENKRKLGGKEATIEERLGAMDLD 447

  Fly   872 ARGRWAQRSTQLET-------ADDLRSNS---------------------ESPLGTV-------- 900
            .||:   :...|:|       |..|.||.                     ..||..|        
  Rat   448 RRGK---KDDLLQTNSFPVLLAQGLESNDFEMLNKVLQTRNVNLIKKTVLRMPLHAVIPLLQELT 509

  Fly   901 SSVGGHSGVNVQTSDYNSASSKDITYNQTYLS-------EDSSIDSGMETRRGELKFIGSSNNGT 958
            ..:.||....|....:....   :|.:.:|||       :..::...||:|....:.:...:...
  Rat   510 KRLQGHPNSAVLMVQWLKCV---LTIHASYLSTLPDLVHQLGTLYQLMESRVKTFQKLSHLHGKL 571

  Fly   959 VVTVSSVSSIAVSASNGAMSTGSGAAQQRLQLPDKRLKPGLRFDTHTHDHDGDVEDISDGERTSS 1023
            ::.|:.|:                |:::..::|...||..|.::..:.:.:.| ::|.  |:.|.
  Rat   572 ILLVTQVT----------------ASEKTKKMPSPGLKAKLVYEEESSEEESD-DEIP--EKDSD 617

  Fly  1024 DHGMFYNNLAPSTPTDFKVTAMNEDELRKSVRRQKFEKSGLQLTPSALSGNGSSHTASTGTGTSD 1088
            |:                   .:|||.:.|...:..::                          |
  Rat   618 DN-------------------WDEDEEKDSENDEAVDE--------------------------D 637

  Fly  1089 TE-DEGSTPSAENAERSLASTLGGSSENLPQSST 1121
            :| ||......|:.|.:....|.|.|:..|::.:
  Rat   638 SENDEAVDEEDEDREAASEKELNGDSDLDPENES 671

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wdr62NP_001259886.1 WD40 73..448 CDD:295369 5/11 (45%)
WD40 repeat 73..107 CDD:293791
WD40 repeat 113..161 CDD:293791
WD40 158..574 CDD:225201 37/182 (20%)
WD40 repeat 167..207 CDD:293791
WD40 repeat 209..285 CDD:293791
WD40 repeat 254..294 CDD:293791
WD40 repeat 303..338 CDD:293791
WD40 repeat 353..407 CDD:293791
WD40 385..747 CDD:225201 66/360 (18%)
WD40 436..748 CDD:295369 66/361 (18%)
WD40 repeat 505..540 CDD:293791 10/36 (28%)
WD40 repeat 546..586 CDD:293791 10/78 (13%)
WD40 repeat 591..631 CDD:293791 7/39 (18%)
WD40 repeat 637..672 CDD:293791 6/36 (17%)
WD40 repeat 679..717 CDD:293791 7/40 (18%)
WD40 repeat 723..749 CDD:293791 3/25 (12%)
Wdr43NP_001032880.2 WD40 19..271 CDD:295369 54/291 (19%)
WD40 <19..217 CDD:225201 40/205 (20%)
WD40 repeat 19..57 CDD:293791 10/30 (33%)
WD40 repeat 63..124 CDD:293791 14/72 (19%)
WD40 repeat 129..165 CDD:293791 4/35 (11%)
WD40 repeat 172..205 CDD:293791 7/35 (20%)
WD40 repeat 211..261 CDD:293791 13/81 (16%)
WD40 repeat 270..317 CDD:293791 11/57 (19%)
Utp12 473..569 CDD:281932 13/98 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337023
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.