DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wdr62 and DCAF4L1

DIOPT Version :9

Sequence 1:NP_001259886.1 Gene:Wdr62 / 33367 FlyBaseID:FBgn0031374 Length:2397 Species:Drosophila melanogaster
Sequence 2:NP_001025126.2 Gene:DCAF4L1 / 285429 HGNCID:27723 Length:396 Species:Homo sapiens


Alignment Length:393 Identity:68/393 - (17%)
Similarity:132/393 - (33%) Gaps:112/393 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   394 LRDISRVGKSHSFLYHSTCIWGVETVPYNVEREPSQTLPEECFVTCSSDDTIRVWGLDGCTNNDI 458
            |:.::|:|.:.|.:...:.:..:....|:       .|..|..|:|.....:::..||..:    
Human    15 LKKVARMGFNASSMLRKSQLGFLNVTSYS-------RLANELRVSCMERKKVQIRSLDPSS---- 68

  Fly   459 YRRNIYSKELLKIVYSDDELQFI--KDQGSSLF----DKAGNSSYDGRNGVRCIKISPELQHLAS 517
                          .:.|...||  ......||    .:...|.| |...:|.:||.        
Human    69 --------------LASDRFNFILASTNSDQLFVVNQVEVEGSKY-GIISLRTLKIP-------- 110

  Fly   518 GDRCGNIRVYSLVNLRL------------LTTIEAHESEVLCLEYSNEKIERKLLASASRDRLIH 570
                 :..||.|.||.:            |..:::|  .:||.|...:.....:|..|||...:|
Human   111 -----SFHVYVLRNLYVPNRKVKSLCWASLNQLDSH--VLLCFEGITDAPSCAVLLPASRFLSVH 168

  Fly   571 V----------FDVAQNYLLLQTLDDHSSSITSIKFVGAGLNFQMI----------SCGADKSIM 615
            .          |.:.:.:....:|:..:....|     |||:.|::          |......::
Human   169 TRVNQPGMLCSFQIPEAWSCAWSLNTRAYHCFS-----AGLSQQVLLTSVATGHQQSFDTSSDVL 228

  Fly   616 FRSF------------QGNIFM-------RGTNTSGKTTLYDMEVDS-----NAKHILTACQDRN 656
            .:.|            .|.||.       ||.........:|..|.|     ..:.::.:.....
Human   229 AQQFASTAPLLFNGCRSGEIFAIDLRCRNRGKGWRATRLFHDSAVTSVQILQEEQCLMASDMTGK 293

  Fly   657 VRVYGTQNAKQTKTFKGSHSDEGSLIKLSL-DPSGIYVAT--SCTDKTLAVYDYYSNECMARMYG 718
            ::::..:..|..:.::| |.:|.:.:.|.: :..||.||.  .|..:..:::|.:....:...|.
Human   294 IKLWDLRATKCVRQYEG-HVNESAYLPLHVHEEEGIVVAVGQDCYTRIWSLHDAHLLRTIPSPYS 357

  Fly   719 HSE 721
            .||
Human   358 ASE 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wdr62NP_001259886.1 WD40 73..448 CDD:295369 9/53 (17%)
WD40 repeat 73..107 CDD:293791
WD40 repeat 113..161 CDD:293791
WD40 158..574 CDD:225201 38/207 (18%)
WD40 repeat 167..207 CDD:293791
WD40 repeat 209..285 CDD:293791
WD40 repeat 254..294 CDD:293791
WD40 repeat 303..338 CDD:293791
WD40 repeat 353..407 CDD:293791 4/12 (33%)
WD40 385..747 CDD:225201 68/393 (17%)
WD40 436..748 CDD:295369 61/351 (17%)
WD40 repeat 505..540 CDD:293791 8/46 (17%)
WD40 repeat 546..586 CDD:293791 10/49 (20%)
WD40 repeat 591..631 CDD:293791 12/68 (18%)
WD40 repeat 637..672 CDD:293791 4/39 (10%)
WD40 repeat 679..717 CDD:293791 7/40 (18%)
WD40 repeat 723..749 CDD:293791
DCAF4L1NP_001025126.2 WD40 repeat 185..220 CDD:293791 6/39 (15%)
WD40 <210..368 CDD:330360 24/152 (16%)
WD40 repeat 228..263 CDD:293791 6/34 (18%)
WD 1 268..307 4/38 (11%)
WD40 repeat 273..309 CDD:293791 3/35 (9%)
WD 2 312..351 8/38 (21%)
WD40 repeat 317..353 CDD:293791 7/35 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143295
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.