DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wdr62 and DCAF4

DIOPT Version :9

Sequence 1:NP_001259886.1 Gene:Wdr62 / 33367 FlyBaseID:FBgn0031374 Length:2397 Species:Drosophila melanogaster
Sequence 2:NP_001339378.1 Gene:DCAF4 / 26094 HGNCID:20229 Length:496 Species:Homo sapiens


Alignment Length:413 Identity:78/413 - (18%)
Similarity:145/413 - (35%) Gaps:113/413 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   449 GLDGCTNNDIYRRNIYSKEL----LKIVYSDDELQFIKDQGSSLFDKAGNSSYDGRNGVRCIKIS 509
            |.:.|  |.:.:.:|..||:    |:::..:|..:.|...|.:.......|.....|......::
Human    84 GHNNC--NPLTKESIRQKEMESKRLRLLQEEDRRKKIARMGFNASSMLRKSQLGFLNVTNYCHLA 146

  Fly   510 PELQ-----------------HLAS-----------GDR---CGNIRV----YSLVNLRLLTT-- 537
            .||:                 .|||           .||   ..:::|    |.::||:.|.|  
Human   147 HELRLSCMERKKVQIRSMDPSALASDRFNLILADTNSDRLFTVNDVKVGGSKYGIINLQSLKTPT 211

  Fly   538 --IEAHESEVLCLEYSNEKIERKLLASASRDRLIHVFDVAQNYLLLQTLD--------------- 585
              :..||:    |.::|.|:.....||     |.|:    .:::||..:.               
Human   212 LKVFMHEN----LYFTNRKVNSVCWAS-----LNHL----DSHILLCLMGLAETPGCATLLPASL 263

  Fly   586 ---------DHSSSITSIKFVGA-----GLNFQMISC---GADKSIMFRS-FQGNIFMRGTNTSG 632
                     |....:.|.:..||     .||.|..:|   |..:.::..: ..|:....|||:. 
Human   264 FVNSHPAGIDRPGMLCSFRIPGAWSCAWSLNIQANNCFSTGLSRRVLLTNVVTGHRQSFGTNSD- 327

  Fly   633 KTTLYDMEVDSNAKHILTACQDRNVRVYGTQNAKQTKTFKGS---HSDEGSLIKLSLDPSGIYVA 694
               :...:....|..:...|:...:.....:...|.|.:|.:   |....:.:::..|..  |:.
Human   328 ---VLAQQFALMAPLLFNGCRSGEIFAIDLRCGNQGKGWKATRLFHDSAVTSVRILQDEQ--YLM 387

  Fly   695 TSCTDKTLAVYDYYSNECMARMYGHSELVTGLKF-TNDCRHLISASGDGCIF-IWQVPHDMIVTM 757
            .|.....:.::|..:.:|:.:..||......|.. .::...::.|.|..|.. ||.: ||     
Human   388 ASDMAGKIKLWDLRTTKCVRQYEGHVNEYAYLPLHVHEEEGILVAVGQDCYTRIWSL-HD----- 446

  Fly   758 QARMSQQRLRSGHAPLPRPLAPI 780
             ||:    ||:..:|.|...|.|
Human   447 -ARL----LRTIPSPYPASKADI 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wdr62NP_001259886.1 WD40 73..448 CDD:295369
WD40 repeat 73..107 CDD:293791
WD40 repeat 113..161 CDD:293791
WD40 158..574 CDD:225201 34/167 (20%)
WD40 repeat 167..207 CDD:293791
WD40 repeat 209..285 CDD:293791
WD40 repeat 254..294 CDD:293791
WD40 repeat 303..338 CDD:293791
WD40 repeat 353..407 CDD:293791
WD40 385..747 CDD:225201 66/378 (17%)
WD40 436..748 CDD:295369 67/379 (18%)
WD40 repeat 505..540 CDD:293791 13/73 (18%)
WD40 repeat 546..586 CDD:293791 9/63 (14%)
WD40 repeat 591..631 CDD:293791 12/48 (25%)
WD40 repeat 637..672 CDD:293791 4/34 (12%)
WD40 repeat 679..717 CDD:293791 5/37 (14%)
WD40 repeat 723..749 CDD:293791 6/27 (22%)
DCAF4NP_001339378.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..66
WD40 repeat 286..323 CDD:293791 7/36 (19%)
WD40 <287..470 CDD:330360 38/195 (19%)
WD40 repeat 329..368 CDD:293791 5/38 (13%)
WD 1 369..408 6/40 (15%)
WD40 repeat 374..410 CDD:293791 5/37 (14%)
WD 2 411..452 13/51 (25%)
WD40 repeat 418..454 CDD:293791 12/46 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143294
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.