DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wdr62 and WDR43

DIOPT Version :9

Sequence 1:NP_001259886.1 Gene:Wdr62 / 33367 FlyBaseID:FBgn0031374 Length:2397 Species:Drosophila melanogaster
Sequence 2:NP_055946.1 Gene:WDR43 / 23160 HGNCID:28945 Length:677 Species:Homo sapiens


Alignment Length:802 Identity:153/802 - (19%)
Similarity:271/802 - (33%) Gaps:272/802 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   436 FVTCSSDDTIRVWGLDGCTNNDIYRRNIYSKEL----LKIVYSDDELQFIKDQGSSLFDKAGNSS 496
            |...|:|..:|||   ...||.:::..:.|..|    ..:.::...||            |..|.
Human    29 FALASTDGHLRVW---ETANNRLHQEYVPSAHLSGTCTCLAWAPARLQ------------AKESP 78

  Fly   497 YDGRNGVRCIKISPELQHLASGDRCGNIRVYSLVNLRLLTTI--EAHESEVLCLEYSNEKIERKL 559
            ...:.....:.:|.:...||.|...|:|.:||.|...|.:.:  ..|::.|.|:::..:.   ..
Human    79 QRKKRKSEAVGMSNQTDLLALGTAVGSILLYSTVKGELHSKLISGGHDNRVNCIQWHQDS---GC 140

  Fly   560 LASASRDRLIHVFDVAQNYLLLQTLDDHSSSITSIKFVGAGLNFQMISCG-------ADKSIMFR 617
            |.|.|.|:.|..::|....:..:...| :||::|:.....|.  .::|.|       .:...::|
Human   141 LYSCSDDKHIVEWNVQTCKVKCKWKGD-NSSVSSLCISPDGK--MLLSAGRTIKLWVLETKEVYR 202

  Fly   618 SFQGN-------IF--MRGTNTS----GKTTLYDMEVDSNAKHILTACQDR--NVRVYGTQNAKQ 667
            .|.|:       :|  :|..|.|    |.|.||.:   |.|.|      ||  ||....::|.::
Human   203 HFTGHATPVSSLMFTTIRPPNESQPFDGITGLYFL---SGAVH------DRLLNVWQVRSENKEK 258

  Fly   668 TKTFKGSHSDEGSLIKLSLDPS---GIYVATSCTDKTLAVYDYYSNECMARMYGHSELVTGLKFT 729
            :.....:.:||...|.|:|..:   .:.:|..|.|..:.::::..|       |:.:    ...|
Human   259 SAVMSFTVTDEPVYIDLTLSENKEEPVKLAVVCRDGQVHLFEHILN-------GYCK----KPLT 312

  Fly   730 NDCRHLISASGDGCIFIWQVPHDMIVTMQARMSQQRLRSGHAPLPRPLAPI------SPPDGIVL 788
            ::|...|:..|                           .|....|:|: ||      |....::|
Human   313 SNCTIQIATPG---------------------------KGKKSTPKPI-PILAAGFCSDKMSLLL 349

  Fly   789 E-----SPTSEIEQPQL---QPKFGVAERFSDVGQLPQWAMRKAAADSDSGALSIPTPSGGSAT- 844
            .     .||  ||:..|   :|...:....|:.     ||.:     .::....:.||...|.. 
Human   350 VYGSWFQPT--IERVALNSREPHMCLVRDISNC-----WAPK-----VETAITKVRTPVMNSEAK 402

  Fly   845 -----VPGMHAASSMGNLSSSPSQQMTGLAPRARG----RWAQR------STQLETADDLRSNS- 893
                 :||.|||     :..:|.|.....:.|..|    ...:|      .|..:..:||::|| 
Human   403 VLVPGIPGHHAA-----IKPAPPQTEQVESKRKSGGNEVSIEERLGAMDIDTHKKGKEDLQTNSF 462

  Fly   894 --------ES-------------------------PLGTV--------SSVGGHSGVNVQTSDYN 917
                    ||                         ||.|:        ..:.||....|....:.
Human   463 PVLLTQGLESNDFEMLNKVLQTRNVNLIKKTVLRMPLHTIIPLLQELTKRLQGHPNSAVLMVQWL 527

  Fly   918 SASSKDITYNQTYLS-------EDSSIDSGMETRRGELKFIGSSNNGTVVTVSSVSSIAVSASNG 975
            ...   :|.:.:|||       :..::...||:|....:.:...:...::.::.|:  |...:.|
Human   528 KCV---LTVHASYLSTLPDLVPQLGTLYQLMESRVKTFQKLSHLHGKLILLITQVT--ASEKTKG 587

  Fly   976 AMSTGSGAAQQRLQLPDKRLKPGLRFDTHTHDHDGDVEDISDGERTSSDHGMFYNNLAPSTPTDF 1040
            |.|.|.              |..|.::..:.:.:.| ::|:|  :.|.|                
Human   588 ATSPGQ--------------KAKLVYEEESSEEESD-DEIAD--KDSED---------------- 619

  Fly  1041 KVTAMNEDELRKSVRRQKFEKSGLQLTPSALSGNGSSHTASTGTGTSDTEDEGSTPSA---ENAE 1102
                 |.||..:....:|.|                           |.|:|......   ||.|
Human   620 -----NWDEDEEESESEKDE---------------------------DVEEEDEDAEGKDEENGE 652

  Fly  1103 -RSLAS--TLGGSSENLPQSST 1121
             |..||  .|.|.|:..|::.:
Human   653 DRDTASEKELNGDSDLDPENES 674

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wdr62NP_001259886.1 WD40 73..448 CDD:295369 4/11 (36%)
WD40 repeat 73..107 CDD:293791
WD40 repeat 113..161 CDD:293791
WD40 158..574 CDD:225201 32/143 (22%)
WD40 repeat 167..207 CDD:293791
WD40 repeat 209..285 CDD:293791
WD40 repeat 254..294 CDD:293791
WD40 repeat 303..338 CDD:293791
WD40 repeat 353..407 CDD:293791
WD40 385..747 CDD:225201 73/341 (21%)
WD40 436..748 CDD:295369 73/342 (21%)
WD40 repeat 505..540 CDD:293791 10/36 (28%)
WD40 repeat 546..586 CDD:293791 7/39 (18%)
WD40 repeat 591..631 CDD:293791 10/55 (18%)
WD40 repeat 637..672 CDD:293791 9/36 (25%)
WD40 repeat 679..717 CDD:293791 7/40 (18%)
WD40 repeat 723..749 CDD:293791 4/25 (16%)
WDR43NP_055946.1 WD 1 11..51 8/24 (33%)
WD40 19..272 CDD:295369 61/272 (22%)
WD40 <19..217 CDD:225201 43/208 (21%)
WD40 repeat 19..57 CDD:293791 9/30 (30%)
WD 2 57..119 15/73 (21%)
WD40 repeat 63..124 CDD:293791 14/72 (19%)
WD 3 124..163 9/41 (22%)
WD40 repeat 129..165 CDD:293791 8/38 (21%)
WD 4 166..205 8/41 (20%)
WD40 repeat 172..205 CDD:293791 5/34 (15%)
WD 5 207..259 16/60 (27%)
WD40 repeat 211..262 CDD:293791 16/59 (27%)
WD 6 267..309 10/52 (19%)
WD40 repeat 271..320 CDD:293791 10/59 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 414..445 6/35 (17%)
Utp12 474..570 CDD:281932 13/98 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 582..677 29/158 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143291
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.