DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wdr62 and wdr-5.3

DIOPT Version :9

Sequence 1:NP_001259886.1 Gene:Wdr62 / 33367 FlyBaseID:FBgn0031374 Length:2397 Species:Drosophila melanogaster
Sequence 2:NP_001024299.1 Gene:wdr-5.3 / 179489 WormBaseID:WBGene00013862 Length:501 Species:Caenorhabditis elegans


Alignment Length:176 Identity:43/176 - (24%)
Similarity:89/176 - (50%) Gaps:18/176 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   578 YLLLQTLDDHSSSITSIKF------VGAGLNFQMISCGADKSIMFRSFQGNIFMRGTNTSGKTTL 636
            :.|::|:..|:.|::.|||      :|.|        .|||.|...:.....::: |..|.:..:
 Worm   203 FSLVKTISGHTKSVSVIKFSYCGKYLGTG--------SADKQIKVWNTVDMTYLQ-TLASHQLGI 258

  Fly   637 YDMEVDSNAKHILTACQDRNVRVYGTQNAKQTKTFKGSHSDEGSLIKLSLDPSGIYVATSCTDKT 701
            .|....||::.|.:|..|..|:::...:....:|.:| |::  .:...|.:|....:|::..|:|
 Worm   259 NDFSWSSNSQFIASASDDTTVKIFDVISGACLRTMRG-HTN--YVFCCSFNPQSSLIASAGFDET 320

  Fly   702 LAVYDYYSNECMARMYGHSELVTGLKFTNDCRHLISASGDGCIFIW 747
            :.|:|:.:..|:..:..||:.:|.:.:.:|...:.::|.||||.:|
 Worm   321 VRVWDFKTGLCVKCIPAHSDPITSISYNHDGNTMATSSYDGCIRVW 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wdr62NP_001259886.1 WD40 73..448 CDD:295369
WD40 repeat 73..107 CDD:293791
WD40 repeat 113..161 CDD:293791
WD40 158..574 CDD:225201
WD40 repeat 167..207 CDD:293791
WD40 repeat 209..285 CDD:293791
WD40 repeat 254..294 CDD:293791
WD40 repeat 303..338 CDD:293791
WD40 repeat 353..407 CDD:293791
WD40 385..747 CDD:225201 42/174 (24%)
WD40 436..748 CDD:295369 43/176 (24%)
WD40 repeat 505..540 CDD:293791
WD40 repeat 546..586 CDD:293791 2/7 (29%)
WD40 repeat 591..631 CDD:293791 10/45 (22%)
WD40 repeat 637..672 CDD:293791 8/34 (24%)
WD40 repeat 679..717 CDD:293791 8/37 (22%)
WD40 repeat 723..749 CDD:293791 8/25 (32%)
wdr-5.3NP_001024299.1 WD40 <200..501 CDD:225201 43/176 (24%)
WD40 205..499 CDD:238121 43/174 (25%)
WD40 repeat 216..253 CDD:293791 10/45 (22%)
WD40 repeat 259..295 CDD:293791 8/35 (23%)
WD40 repeat 300..336 CDD:293791 8/35 (23%)
WD40 repeat 343..378 CDD:293791 8/24 (33%)
WD40 repeat 385..421 CDD:293791
WD40 repeat 429..466 CDD:293791
WD40 repeat 472..498 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157526
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.