DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wdr62 and DCAF4L2

DIOPT Version :9

Sequence 1:NP_001259886.1 Gene:Wdr62 / 33367 FlyBaseID:FBgn0031374 Length:2397 Species:Drosophila melanogaster
Sequence 2:NP_689631.1 Gene:DCAF4L2 / 138009 HGNCID:26657 Length:395 Species:Homo sapiens


Alignment Length:412 Identity:84/412 - (20%)
Similarity:147/412 - (35%) Gaps:101/412 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 LEGGRKYKDPI------PLMGRSAILGDLRDNDFCAVACGKGICAESTYAITRQGHLVEFSS--- 289
            ||...|.|..:      |.|.|...||.||..::|.:|....:.......:  |.|..:.||   
Human     9 LEEADKQKKTVRVGLNAPSMLRKNQLGFLRFANYCRIARELRVSCMQRKKV--QIHSWDPSSLAS 71

  Fly   290 ---RRLLDKWVQCRTTNANCICVNE------RFILV---GCAESIIRIFNSATLEYVTTLPRTHY 342
               .|:|     ..|.......||:      ::.::   |.....:|::...|| ||....    
Human    72 DRFNRIL-----ANTNTDQLFTVNQVEAGGSKYGIITMRGLTTPELRVYPHKTL-YVPNRK---- 126

  Fly   343 LGVDVAQGIQINH-----IMSVPQQAKFPDCIAMVFDEQRSKVSCVYNDHSLYIWDLRDISRVGK 402
              |:......:||     ::.....|..|.|..::             ..||:|.....:.|.|.
Human   127 --VNSMCWASLNHLDSHLLLCFVGLADTPSCAVLL-------------PASLFIGSFPGMRRPGM 176

  Fly   403 SHSFLYHS--TCIWGVETVPYNVEREPSQTLPEECFVT-----------CSSDDTIRVWGL---- 450
            ..||....  :|.|.:....|:   ..|..|.::..:|           .|||...:.:.:    
Human   177 LCSFQIPDAWSCAWSLSIHAYH---SFSTGLSQQVLLTNVVTGHQQSFGTSSDVLAQQFAIMTPL 238

  Fly   451 --DGCTNNDIYRRNIYSKELLKIVYSDDELQFIKDQGSSLFDKAGNSSYDGRNGVRCIKISPELQ 513
              :||.:.:|:..::.                ..:|||..  ||...|:|  :.|..::|..:.|
Human   239 LFNGCRSGEIFGIDLR----------------CGNQGSGW--KAICLSHD--SAVTSLQILQDGQ 283

  Fly   514 HLASGDRCGNIRVYSLVNLRLLTTIEAHESEVLCLE-YSNEKIERKLLASASRDRLIHVFDVAQN 577
            .|.|.|..|.|:::.|...:.:|..|.|.:....|. :.||  |..::|:..:|....::.:...
Human   284 FLVSSDMTGTIKLWDLRATKCVTQYEGHVNNSAYLPVHVNE--EEGVVAAVGQDCYTRIWSLRHG 346

  Fly   578 YLLLQTLDDHSSS---ITSIKF 596
            :||......:.:|   |.|:.|
Human   347 HLLTTIPSPYPASENDIPSVAF 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wdr62NP_001259886.1 WD40 73..448 CDD:295369 50/252 (20%)
WD40 repeat 73..107 CDD:293791
WD40 repeat 113..161 CDD:293791
WD40 158..574 CDD:225201 78/385 (20%)
WD40 repeat 167..207 CDD:293791
WD40 repeat 209..285 CDD:293791 15/56 (27%)
WD40 repeat 254..294 CDD:293791 10/45 (22%)
WD40 repeat 303..338 CDD:293791 8/43 (19%)
WD40 repeat 353..407 CDD:293791 11/58 (19%)
WD40 385..747 CDD:225201 50/235 (21%)
WD40 436..748 CDD:295369 38/182 (21%)
WD40 repeat 505..540 CDD:293791 9/34 (26%)
WD40 repeat 546..586 CDD:293791 8/40 (20%)
WD40 repeat 591..631 CDD:293791 3/6 (50%)
WD40 repeat 637..672 CDD:293791
WD40 repeat 679..717 CDD:293791
WD40 repeat 723..749 CDD:293791
DCAF4L2NP_689631.1 WD40 <186..300 CDD:225201 27/136 (20%)
WD40 repeat 223..267 CDD:293791 11/61 (18%)
WD 1 268..307 11/40 (28%)
WD40 <269..>369 CDD:330360 25/104 (24%)
WD40 repeat 273..309 CDD:293791 10/35 (29%)
WD 2 312..351 8/40 (20%)
WD40 repeat 317..353 CDD:293791 8/37 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143293
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.