DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and CLEC6A

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001007034.1 Gene:CLEC6A / 93978 HGNCID:14556 Length:209 Species:Homo sapiens


Alignment Length:158 Identity:35/158 - (22%)
Similarity:67/158 - (42%) Gaps:20/158 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 RLDRLESQQAALLRILSKFDRKIVAP-------KFELIGSRFFYIEDETRRNWTSAGSACRQMGT 158
            ||..|.|..::    |:.|......|       .::..||..::|..| .:.|:.:...|.:||.
Human    53 RLSELHSYHSS----LTCFSEGTKVPAWGCCPASWKSFGSSCYFISSE-EKVWSKSEQNCVEMGA 112

  Fly   159 QLATIRSAEELAALRAKLNKERHYWLDITDLEKEGDFR-ISASGKRPNFLKWRAGQPNNFSGNQH 222
            .|....:..|...:..:||:...|:|.::|.:...::: |..:....|...|..|:||:.:  :.
Human   113 HLVVFNTEAEQNFIVQQLNESFSYFLGLSDPQGNNNWQWIDKTPYEKNVRFWHLGEPNHSA--EQ 175

  Fly   223 CVDLL----DGLMY-DNKCESLSYFICQ 245
            |..::    .|..: |..||:....||:
Human   176 CASIVFWKPTGWGWNDVICETRRNSICE 203

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 24/109 (22%)
CLEC6ANP_001007034.1 CLECT_DC-SIGN_like 79..204 CDD:153060 28/128 (22%)
Alpha-D-mannopyranose binding. /evidence=ECO:0000269|PubMed:28652405, ECO:0007744|PDB:5VYB 168..170 0/1 (0%)