DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and MARCO

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_006761.1 Gene:MARCO / 8685 HGNCID:6895 Length:520 Species:Homo sapiens


Alignment Length:79 Identity:23/79 - (29%)
Similarity:31/79 - (39%) Gaps:15/79 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLALFAWNAHAPSAAMPSVCLLQDAPQQCGEFCLTALSPMLDHIARHEGEWTSSVLQANATEARL 73
            :|.::..|....:...||..|||.|  ..||           |:|  :|.....||||..|..|:
Human    76 VLEMYFLNDTLAAEDSPSFSLLQSA--HPGE-----------HLA--QGASRLQVLQAQLTWVRV 125

  Fly    74 ARIETLQTAMNIRQ 87
            :....||...|..|
Human   126 SHEHLLQRVDNFTQ 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057
MARCONP_006761.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 142..423
Collagen 205..256 CDD:189968
Collagen 244..303 CDD:189968
Collagen 286..344 CDD:189968
Collagen 334..393 CDD:189968
SR 424..519 CDD:214555
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.