DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and asgrl3

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_021332405.1 Gene:asgrl3 / 799269 ZFINID:ZDB-GENE-060526-152 Length:311 Species:Danio rerio


Alignment Length:287 Identity:63/287 - (21%)
Similarity:97/287 - (33%) Gaps:93/287 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SVCLLQDAPQQCGEFCLTALSPMLDHIARHEGEWTSSVLQANATEARLARIETLQTAMNIRQKVL 90
            |:|..:...:|.|...|.....|:..:.     ..|.::||.    :|:.||||.|         
Zfish    48 SLCKGRPCSKQTGILVLLGTVGMIIFLV-----LISIIVQAK----KLSDIETLMT--------- 94

  Fly    91 QEGFPKDIVARLD-----------RLESQQ---------------AALLRILSKFDRKIVAPKFE 129
                  |:.:.||           :||.||               |::..|:||.....|...|.
Zfish    95 ------DLSSSLDSLTSKHEENQQKLERQQNVSYIQVKKQMDTVRASVSSIMSKLKADSVRTSFM 153

  Fly   130 LIG--SRFF------------------------YIEDETRRNWTSAGSACRQMGTQLATIRSAEE 168
            ...  .||.                        |:....:.|||.|...|.:.|..|..|....|
Zfish   154 FRHPLERFLIEHSSEELESGCSDSAWVPFGNSCYLFSRDKMNWTEAKDYCEEKGAWLLKIEDDSE 218

  Fly   169 LAALRAKLN------KERHYWLDITDLEKEGDFRISASGKRPNFLK--WRAGQPNNFSGN----- 220
            ...:|.:..      ...|||:.:|| :..|.:| .|.|......|  |..|||:.::.:     
Zfish   219 DEWVRNECQFVTDFANPTHYWIGLTD-QNTGQWR-WADGTNYTMNKEHWGPGQPDEWTEHSLGEE 281

  Fly   221 -QHCVDL-LDGLMYDNKCESLSYFICQ 245
             :.|.:: .:.|:.|..|.|...|||:
Zfish   282 GEDCAEITYESLLNDLHCSSKIKFICE 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 31/118 (26%)
asgrl3XP_021332405.1 CLECT_DC-SIGN_like 179..309 CDD:153060 33/132 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.