DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and Clec4g

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_083741.1 Gene:Clec4g / 75863 MGIID:1923113 Length:294 Species:Mus musculus


Alignment Length:283 Identity:68/283 - (24%)
Similarity:109/283 - (38%) Gaps:69/283 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LSIWLLLALFAWNAHAPSAAMPSVCLLQDAPQQCGEFCLTALSPMLDHIARHEGEWTSSVLQANA 68
            |.:.||:|...|       |:....||..|..:        |..:|.|         ..:|:.||
Mouse    34 LVLALLVATVLW-------ALILSTLLSSASSK--------LRVLLSH---------QDLLRTNA 74

  Fly    69 TEARLA------RIETLQTAMNIRQKVLQEGFP--KDIVARLDRLES----QQAALLRILSKFDR 121
            :|.::.      .|...:...::.:..||....  |||.|:|...||    .|..:.:.|:|..|
Mouse    75 SEQKMTLSSLKDDIGACRNCCSVTKAQLQTTLAEFKDIQAKLMEQESILKELQERVTQDLAKASR 139

  Fly   122 ---KIVAPKFELI---------------------GSRFFYIEDETRRNWTSAGSACRQMGTQLAT 162
               .|.:..|:.:                     ||.:::  .||:..|.:|.|.|...|..|..
Mouse   140 DRENIRSELFQALEAVKRQNSSCEQCPPSWLPFQGSCYYF--SETQATWDTAQSYCGGQGAHLVI 202

  Fly   163 IRSAEELAALRAKLNKERHYWLD---ITDLEKEGDFRISASGKRPNFLKWRAGQPNNFSGNQHCV 224
            :|...|...| ::..:.|.|||.   :..|.|...:| ...|...||..|.:|:||:..|::.|:
Mouse   203 VRGLNEQGFL-SQHTRGRGYWLGLRAVRHLNKIQGYR-WVDGASLNFSHWNSGEPNDSRGHEDCI 265

  Fly   225 DLL-DGLMYDNKC-ESLSYFICQ 245
            .:| .||..|..| .....:||:
Mouse   266 MMLHSGLWNDAPCTNERDGWICE 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 33/108 (31%)
Clec4gNP_083741.1 COG6 61..>163 CDD:303003 22/110 (20%)
CLECT 165..289 CDD:295302 36/128 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.