DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and lectin-22C

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster


Alignment Length:267 Identity:92/267 - (34%)
Similarity:140/267 - (52%) Gaps:20/267 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQKLSIWLLLALFAWNAHAPSAAMPSVCLLQDAPQQCGEFCLTALSPMLDHIA-------RHEGE 58
            |.|.:..||..|.|.|.:...|....:|.|:|.|.|||.|||..|:|:|:|:.       .:...
  Fly     1 MLKSASALLCGLLALNLYGAWAESDVICPLKDPPSQCGGFCLGVLTPVLNHLTISQNLANSNNSS 65

  Fly    59 WTSSVL--------QANATEARLARIETLQTAMNIRQKVLQEGFPKDIVARLDRLESQQAALLRI 115
            ..:.||        |..|.:.:...||....|...:..|.::.|.:    ||:.:|...:||.:.
  Fly    66 KANEVLVRQYTMEGQLTALQNKQLSIEVALDAQGRKLNVNEQNFTE----RLNCMEGILSALEKT 126

  Fly   116 LSKFDRKIVAPKFELIGSRFFYIEDETRRNWTSAGSACRQMGTQLATIRSAEELAALRAKLNKER 180
            :.:...||....||.|||:::|||..:.:||::|...||.||..||.|:...:|||::|.|.::.
  Fly   127 VLEVKTKIKYLGFEQIGSKYYYIEKVSEKNWSTASKTCRNMGGHLADIKDEADLAAIKANLKEDT 191

  Fly   181 HYWLDITDLEKEGDFRISASGKRPNFLKWRAGQPNNFSGNQHCVDLLDGLMYDNKCESLSYFICQ 245
            ||||.|.||:.||.|....:||:..||||.:|:|:... ..:||.|.:|.|||..|.....||||
  Fly   192 HYWLGINDLDHEGKFLSMPTGKQTTFLKWASGRPSQLD-TLNCVFLYNGEMYDYPCHYTFRFICQ 255

  Fly   246 SDDDSLD 252
            ::::.|:
  Fly   256 TEEEDLN 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 43/103 (42%)
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 46/109 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448746
Domainoid 1 1.000 63 1.000 Domainoid score I6773
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.