DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and SFTPA2

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_005270185.1 Gene:SFTPA2 / 729238 HGNCID:10799 Length:265 Species:Homo sapiens


Alignment Length:161 Identity:43/161 - (26%)
Similarity:70/161 - (43%) Gaps:19/161 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 PKDIVARLDRLESQQAALLRILSKFDRKIVAPKFEL--------IGSRFFYIEDETRRNWTSAGS 151
            |..:.|.||  |..||.    |..|..:|:..:..|        :|.:.|....:: ..:.:...
Human   113 PPGLPAHLD--EELQAT----LHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQS-ITFDAIQE 170

  Fly   152 ACRQMGTQLATIRSAEELAALRAKLNKERHY-WLDITDLEKEGDFRISASGKRPNFLKWRAGQPN 215
            ||.:.|.::|..|:.||..|:.:.:.|...| ::.:|:....||||.| .|...|:..|..|:|.
Human   171 ACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYS-DGTPVNYTNWYRGEPA 234

  Fly   216 NFSGNQHCVDL-LDGLMYDNKCESLSYFICQ 245
            . .|.:.||:: .||...|..|......||:
Human   235 G-RGKEQCVEMYTDGQWNDRNCLYSRLTICE 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 29/105 (28%)
SFTPA2XP_005270185.1 Collagen 45..117 CDD:189968 1/3 (33%)
CLECT_collectin_like 153..265 CDD:153061 31/115 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I5300
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.