DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and Cd209b

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_081248.4 Gene:Cd209b / 69165 MGIID:1916415 Length:325 Species:Mus musculus


Alignment Length:245 Identity:64/245 - (26%)
Similarity:112/245 - (45%) Gaps:46/245 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LLQDAPQQCGEFCLTALSPMLDHIARHEGEWTSSVLQANATEARLARIETLQTAMNIRQKVLQEG 93
            :||:..|...|  ||:..|:        .:..:..:||..||    ::..|:|.:..|..:.| |
Mouse    90 ILQELTQLTDE--LTSRIPI--------SQGKNESMQAKITE----QLMQLKTELLSRIPIFQ-G 139

  Fly    94 FPKDIVARL-DRLESQQAALLRILSKFD-----------RKIVAPKFE--------------LIG 132
            ..:.|..:: ::|...:|.||..:|.|.           :::|..|.|              |:|
Mouse   140 QNESIQEKISEQLMQLKAELLSKISSFPVKDDSKQEKIYQQLVQMKTELFRLCRLCPWDWTFLLG 204

  Fly   133 SRFFYIEDETRRNWTSAGSACRQMGTQLATIRSAEELAALRAKLNKERHYWLDITDLEKEGDFR- 196
            :.:|:  .:::|||..|.:||:::..||..|.|.||...|:.....:...|:.::||:||..:. 
Mouse   205 NCYFF--SKSQRNWNDAVTACKEVKAQLVIINSDEEQTFLQQTSKAKGPTWMGLSDLKKEATWLW 267

  Fly   197 ISASGKRPNFLK-WRAGQPNNFSGNQHCVDLLDGLMYDNKCESLSYFICQ 245
            :..|.....|.| |..|:|||. |.:.||:.......|:|||...::||:
Mouse   268 VDGSTLSSRFQKYWNRGEPNNI-GEEDCVEFAGDGWNDSKCELKKFWICK 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 34/105 (32%)
Cd209bNP_081248.4 CLECT_DC-SIGN_like 195..317 CDD:153060 38/125 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 77 1.000 Domainoid score I8813
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.