DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and Cd209c

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_006248854.1 Gene:Cd209c / 688951 RGDID:1582956 Length:240 Species:Rattus norvegicus


Alignment Length:117 Identity:34/117 - (29%)
Similarity:67/117 - (57%) Gaps:7/117 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 GSRFFYIEDETRRNWTSAGSACRQMGTQLATIRSAEELAALRAKLNKERHY-WLDITDLEKEGDF 195
            |:.:|:  .:.::||..:.::||::|.||..::|.:|.:.|: :.:||:.| |:.::||::||.:
  Rat   119 GNCYFF--SKFQQNWKDSVTSCRKLGAQLVVVKSDDEQSFLQ-QTSKEKGYAWMVLSDLKREGIW 180

  Fly   196 R-ISASGKRPNFLK-WRAGQPNNFSGNQHCVDLLDGLMYDNKCESLSYFICQ 245
            . :..|....:|.| |..|:||| ...:.|.:.......|..|.:..|:||:
  Rat   181 HWVDGSHLLFSFTKYWNKGEPNN-EWEEDCAEFRGDGWNDAPCTNKKYWICK 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 31/106 (29%)
Cd209cXP_006248854.1 CLECT_DC-SIGN_like 110..232 CDD:153060 34/117 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 71 1.000 Domainoid score I9193
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.