DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG15358 and CLEC7A

DIOPT Version :9

Sequence 1:	NP_001303306.2	Gene:	CG15358 / 33366	FlyBaseID:	FBgn0031373	Length:	252	Species:	Drosophila melanogaster
Sequence 2:	NP_922938.1	Gene:	CLEC7A / 64581	HGNCID:	14558	Length:	247	Species:	Homo sapiens

Alignment Length:	132	Identity:	26/132 - (19%)
Similarity:	52/132 - (39%)	Gaps:	30/132 - (22%)

- Green bases have known domain annotations that are detailed below.

  Fly   130 LIGSRFFYIEDETRRNWTSAGSACRQMGTQLATIRSAEELAALRAKLNK--ERHYWLDITDLEKE 192
            :|..:..|:...:..:|..:...|.|:|:.|..|.|:.||..:..:::.  :..:|:.::..:.|
Human   125 IIYEKSCYLFSMSLNSWDGSKRQCWQLGSNLLKIDSSNELGFIVKQVSSQPDNSFWIGLSRPQTE 189

  Fly   193 GDFRISASGKRPNFLKWRAGQPNNFSGN--------------QHCVDLLDGLMYDNKCESLSYFI 243
                          :.|.....:.||.|              .:||.:...::||..|...||.|
Human   190 --------------VPWLWEDGSTFSSNLFQIRTTATQENPSPNCVWIHVSVIYDQLCSVPSYSI 240

  Fly   244 CQ 245
            |:
Human   241 CE 242

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG15358	NP_001303306.2	CLECT	141..245	CDD:153057	23/119 (19%)
CLEC7A	NP_922938.1	ITAM-like	15..18
		Ly49	40..>67	CDD:285577
		CLECT_NK_receptors_like	120..243	CDD:153063	26/132 (20%)
		(1,3-beta-D-glucosyl)n binding. /evidence=ECO:0000250\|UniProtKB:Q6QLQ4	146..153		2/6 (33%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910