DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and si:dkey-9i23.5

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001139081.1 Gene:si:dkey-9i23.5 / 571862 ZFINID:ZDB-GENE-090313-364 Length:189 Species:Danio rerio


Alignment Length:127 Identity:36/127 - (28%)
Similarity:60/127 - (47%) Gaps:18/127 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 IGSR---FFYIEDETRRNWTSAGSACRQM--GTQLATIRSAEE---LAALRAKLN-KERHYWLDI 186
            :|.|   :|:    :|.|:|.|...||..  |..|.::.::::   |..:..|.| |....||..
Zfish    55 VGQRCVKYFF----SRLNFTLAEFKCRSKAPGAHLVSVHNSQDNNYLLCIVKKFNPKSLRIWLGA 115

  Fly   187 TDLEKEGDFRISASGKRPNFLKWRAGQPNN-FSGNQHCVDL---LDGLMYDNKCESLSYFIC 244
            .:..|.|:| ....|...||.:|..|:||: ::.|:.|:::   ..|...|:||.....|||
Zfish   116 YEFFKSGEF-FWLDGSFWNFNRWVPGEPNHMYTSNEECLEMNWKEAGKWNDDKCNVRKSFIC 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 33/114 (29%)
si:dkey-9i23.5NP_001139081.1 CLECT 58..176 CDD:153057 33/122 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.