DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and Clec4n

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_064385.1 Gene:Clec4n / 56620 MGIID:1861231 Length:209 Species:Mus musculus


Alignment Length:125 Identity:32/125 - (25%)
Similarity:54/125 - (43%) Gaps:19/125 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 GSRFFYIEDETRRN-WTSAGSACRQMGTQLATIRSAEELAALRAKLNKERHYWLDITDLEKEGDF 195
            ||..:.|  .|:.| |:::...|.|||..|..|.:..|...:..:||:...|:|.::|.:..|.:
Mouse    87 GSSCYLI--STKENFWSTSEQNCVQMGAHLVVINTEAEQNFITQQLNESLSYFLGLSDPQGNGKW 149

  Fly   196 R-ISASGKRPNFLKWRAGQPNNFSGNQHCVDLLDGLMYDNK---------CESLSYFICQ 245
            : |..:....|...|...:||  ...:.||    .::|.|.         |:|....||:
Mouse   150 QWIDDTPFSQNVRFWHPHEPN--LPEERCV----SIVYWNPSKWGWNDVFCDSKHNSICE 203

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 28/114 (25%)
Clec4nNP_064385.1 CLECT_DC-SIGN_like 79..204 CDD:153060 32/125 (26%)
Alpha-D-mannopyranose binding. /evidence=ECO:0000250|UniProtKB:Q6EIG7 168..170 0/1 (0%)