DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and zgc:174904

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001170922.1 Gene:zgc:174904 / 564690 ZFINID:ZDB-GENE-080204-76 Length:320 Species:Danio rerio


Alignment Length:281 Identity:67/281 - (23%)
Similarity:108/281 - (38%) Gaps:57/281 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLLALFAWNAHA---PSAAMPSVCLLQDAPQQCGEFCLTALSPMLDHIARHEGEWTSSVLQANAT 69
            |||.|.....||   .|:...|......|.||.|...:|||:..|....|.:.|     |:.:.:
Zfish    59 LLLVLVVTGLHAGKTSSSGQGSSSSAAAAHQQTGSINVTALTTELQTAKREKSE-----LEKDKS 118

  Fly    70 EARLARIETLQTAMNIRQKVLQEGFPKDIVARLDRLESQQAALLRILSKFDRKIV------APKF 128
            |....:.|..:....:.:|      ..::..|...||.:::.|.:.|.:...|:.      ||:.
Zfish   119 ELEKKKRELEKEKSELEKK------KSELEKRKSELEKEKSELQKELLQLKDKVTKCEVTPAPRT 177

  Fly   129 --------------ELIGSRFFYIEDETRRNWTSAGSACRQMGTQLATIRSAEELAAL-----RA 174
                          ...||.:|.  ..|.|:||.:.:.|::.|..||.|.:|||...:     |.
Zfish   178 TPAPTTSPCPQNWKHFNGSCYFI--SVTTRSWTDSQTYCKRYGGHLAIILTAEEQTFIWDLLPRG 240

  Fly   175 KLNKERHYWLDITDLEKEGDFR-ISASGKRPNFLKWRAGQPNNFSGNQHC-----VDLLDGL--- 230
            ..|.   :|..|:|.:.|.|:. :..:.....|  |..|:|||.. ::.|     .|:|..:   
Zfish   241 YWNA---FWFGISDEKVEDDWHWVDGTKLVGGF--WEDGEPNNHI-DEDCGYMIKTDVLTRVAIK 299

  Fly   231 -MYDNKCESLSYFICQSDDDS 250
             .||..|.....:||:....|
Zfish   300 SWYDAPCHMSLPWICEKPASS 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 32/118 (27%)
zgc:174904NP_001170922.1 CLECT_DC-SIGN_like 186..316 CDD:153060 36/137 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X73
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.