DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and si:ch211-63p21.3

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_001919193.1 Gene:si:ch211-63p21.3 / 562103 ZFINID:ZDB-GENE-160113-18 Length:368 Species:Danio rerio


Alignment Length:130 Identity:30/130 - (23%)
Similarity:53/130 - (40%) Gaps:34/130 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 ELIGSRFFYIEDETRRNWTSAGSACRQMGTQLATIRSAEELAALRAKL--------------NKE 179
            |.:..::.:|.:  .:|||.|...||:..|.|||:.:..::..|:..|              |..
Zfish    19 ECVQRQYHFINE--NKNWTEAQRYCRENYTDLATVDNMNDMNQLKNSLDVNYGVVWIGLQGTNVS 81

  Fly   180 RHYWLDITDLEKEGDFRISASGKRPNFLKWRAGQPNNFSGNQHCVDLLDGLMYDNKCESLSYFIC 244
            ..:|               :||....||.|.:|||.:   :.:|..:::|..:...|.:...|||
Zfish    82 NWHW---------------SSGDSVLFLNWASGQPYS---SDNCAVMINGKWFVGACTATWTFIC 128

  Fly   245  244
            Zfish   129  128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 28/118 (24%)
si:ch211-63p21.3XP_001919193.1 CLECT_1 23..130 CDD:153072 29/126 (23%)
CLECT 135..247 CDD:295302
CLECT 253..365 CDD:153057
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.