DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and si:ch211-282j17.10

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001026840.1 Gene:si:ch211-282j17.10 / 557030 ZFINID:ZDB-GENE-041210-283 Length:368 Species:Danio rerio


Alignment Length:119 Identity:28/119 - (23%)
Similarity:55/119 - (46%) Gaps:11/119 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 ELIGSRFFYIEDETRRNWTSAGSACRQMGTQLATIRSAEELAALRAKLNKER--HYWLDITDLEK 191
            |.:..::.:|.:  ::|.|.|...||:....|||:.:..:...|...:|..|  :.|:   .|::
Zfish    19 ESVQHQYHFINE--KKNCTEAQRYCREKYKDLATVDNMNDTIELIKSVNNARVQNIWI---GLQR 78

  Fly   192 EGDFRIS-ASGKRPNFLKWRAGQPNNFSGNQHCVDLLDGLMYDNKCESLSYFIC 244
            ...::.. :||....||.|.:.:|   :||..|..:.:|...:..|.:...|:|
Zfish    79 TSVYKWHWSSGDPVFFLNWTSEEP---AGNNECTVMNNGQWINEACNNTRVFVC 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 26/107 (24%)
si:ch211-282j17.10NP_001026840.1 CLECT 24..131 CDD:295302 27/114 (24%)
CLECT_1 134..247 CDD:153072
CLECT 253..365 CDD:153057
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.