DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and lectin-21Ca

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster


Alignment Length:233 Identity:84/233 - (36%)
Similarity:117/233 - (50%) Gaps:27/233 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 EFCLTALSPMLDHIA-RHEGEWTS-SVLQANATEARLARIETLQTAMNIRQKVLQEGFP------ 95
            |.||..|:|:|.:|: .|:..|.| :.:|.|.|..:||:||..:...|.:.||:.:...      
  Fly    34 EVCLVELAPVLKYISNNHKSHWNSANEVQVNETRKQLAKIEGQEKETNDKIKVIHDNVDNEFNAL 98

  Fly    96 -------KDIVARLDRLESQQAALLRILS-KFDRKIVAPK------FELIGSRFFYIEDETRRNW 146
                   |:|...|..||.|.....:.|: ..:.|.|.||      |:.||.|.|:||.:.:.:|
  Fly    99 SAKIKNVKNIQRHLASLELQLQETKKALNLSVEAKKVMPKTEIPSQFQKIGWRHFFIEKKHKVDW 163

  Fly   147 TSAGSACRQMGTQLATIRSAEELAALRAKL---NKERH-YWLDITDLEKEGDFRISASGKRPNFL 207
            ..|.|.|.:||..|.||:|.:||.|:|.:|   |...| :||||.|:.|.|:|...|:|..|.||
  Fly   164 FKATSMCHKMGAHLLTIQSEDELDAIRTELKDINDGSHDFWLDINDIAKWGEFISLATGMNPPFL 228

  Fly   208 KWRAGQPNNFSGNQHCVDLLDGLMYDNKCESLSYFICQ 245
            ||...:| ....:|.||.|..|.|.|.||.....||||
  Fly   229 KWHKHRP-QVQIHQRCVHLRGGEMMDGKCSEQFLFICQ 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 44/107 (41%)
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 44/107 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448774
Domainoid 1 1.000 63 1.000 Domainoid score I6773
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 1 1.000 - - otm72280
orthoMCL 1 0.900 - - OOG6_100086
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.