DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and lectin-24A

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster


Alignment Length:291 Identity:86/291 - (29%)
Similarity:138/291 - (47%) Gaps:58/291 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQKLSIWLLLALFAWNAHAPSAAMPSVCLLQDAPQQCGEFCLTALSPMLDHIARHEGEW-TSSVL 64
            |.:||:.:|..|..  :|..||....: .:|..|..|..:|...|.|:::::|.|:.:| |.:.:
  Fly     1 MFRLSVLVLNLLLV--SHEFSAGTAKI-EIQPLPALCNGYCFPTLKPVMEYVAIHQDKWNTCTEI 62

  Fly    65 QANATEARLARIETLQTAMNIRQKVLQ--------EGFPKDIVARLDRLESQQAALLRILS---- 117
            .||  |||..:|:     :||:...|:        ....||  .:|||:|.:|.|:...|.    
  Fly    63 LAN--EARKDQIQ-----LNIQLDALKADVSNIKASQLSKD--EKLDRMEREQFAMHESLETINR 118

  Fly   118 ----KFDR-----------------------------KIVAPKFELIGSRFFYIEDETRRNWTSA 149
                |.||                             :.:.|.||.||.|:||||::...||..|
  Fly   119 YLTVKLDRTKLQLEAIKNTMDYMKAQMDGYFSAINGVQCLQPGFEKIGDRYFYIEEDVELNWLDA 183

  Fly   150 GSACRQMGTQLATIRSAEELAALRAKLNKERHYWLDITDLEKEGDFRISASGKRPNFLKWRAGQP 214
            .:.||:||..||:|::.:|..|:..||:..:.|:|.:.:..|.|||..:||||...:.:|..|:|
  Fly   184 QAKCRRMGGHLASIKTKQEFDAIVEKLDDSKSYFLGVNENTKTGDFVSAASGKSCLYHEWGPGEP 248

  Fly   215 NNFSGNQHCVDLLDGLMYDNKCESLSYFICQ 245
            ::.:..:.||.:|..||:...|.....||||
  Fly   249 HHNNDQERCVSILRKLMHVGNCTYEKRFICQ 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 35/103 (34%)
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 41/111 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448780
Domainoid 1 1.000 56 1.000 Domainoid score I10963
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 1 1.000 - - otm72280
orthoMCL 1 0.900 - - OOG6_100086
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.