DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and lectin-28C

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001285727.1 Gene:lectin-28C / 53542 FlyBaseID:FBgn0040099 Length:265 Species:Drosophila melanogaster


Alignment Length:268 Identity:96/268 - (35%)
Similarity:151/268 - (56%) Gaps:23/268 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQKLSIWLLLALFAWNAHA-PSAAMPS---VCLLQDAPQQCGEFCLTALSPMLDHIARHEGEWTS 61
            |.:|.:.|..|:.|...:| ||....:   ||.|:|...|||.|||.||.|::.|||:|:.:|.:
  Fly     1 MFQLKVLLYYAIIAIVINASPSGCEETDRVVCQLEDPRNQCGPFCLEALMPLIGHIAQHQEQWKT 65

  Fly    62 SVLQANATEAR--LARIETLQTAMNIR-QKVLQEGFPKDIVARLDR----LESQ----QAALLRI 115
            ..||....:.|  ...||:.:|::... :|::.|    ||..|.:|    :|.|    |.||..|
  Fly    66 CKLQEIQAQQRDIEKEIESQKTSLTESWKKIIAE----DIENRTNRSELKMEGQLSDLQEALTSI 126

  Fly   116 ---LSKFDRKI-VAPKFELIGSRFFYIEDETRRNWTSAGSACRQMGTQLATIRSAEELAALRAKL 176
               |.....|| :..:|:.||||:.:|||..::|||||.|||::||..||:|.:..:..|:.::|
  Fly   127 TTSLKNMSAKINILHRFKRIGSRYLHIEDIVQQNWTSALSACQKMGGNLASIINEADFNAIVSQL 191

  Fly   177 NKERHYWLDITDLEKEGDFRISASGKRPNFLKWRAGQPNNFSGNQHCVDLLDGLMYDNKCESLSY 241
            :|:..|.:.|:||.::|.|...:||||..||||..|:|.....:|.||.:.:|.|:...|.|...
  Fly   192 SKDNTYMIGISDLAEKGVFISVSSGKRAPFLKWNPGEPLYEHVDQRCVSIHNGGMWVASCTSDFK 256

  Fly   242 FICQSDDD 249
            :||:::::
  Fly   257 YICEANEN 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 40/103 (39%)
lectin-28CNP_001285727.1 Mer2 <12..134 CDD:286200 41/125 (33%)
CLECT 160..260 CDD:153057 40/99 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 63 1.000 Domainoid score I6773
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 1 1.000 - - otm72280
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.