DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and lectin-30A

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_652635.2 Gene:lectin-30A / 53541 FlyBaseID:FBgn0040097 Length:223 Species:Drosophila melanogaster


Alignment Length:218 Identity:60/218 - (27%)
Similarity:103/218 - (47%) Gaps:43/218 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 MLDHIARHEGEW-TSSVLQANATEARLARIETLQTAMNIRQKVLQEGFPKDIVARLDRLESQQAA 111
            ::|.:|.::.:| |...|:.:..:.::.|||                  :.|..||..::|:.|.
  Fly    28 LIDQVAINQQQWFTFIALKESEMQQKIVRIE------------------RSIEERLMAMQSKLAY 74

  Fly   112 LLRILS--------------KFDRKIVAPKFELIGSRFFYIEDETRRNWTSAGSACRQMGTQLAT 162
            .|..|.              :...:|....|:.:|:|.||||.|.::||..|.:.|||:|..:||
  Fly    75 ALNELQTIMGNQSVETLEKLRISHRINPALFQRMGTRRFYIEKENKQNWFGASNTCRQLGGHIAT 139

  Fly   163 IRSAEELAAL--RAKLNKERHYWLDITDLEKEGDFRISASGKRPNFLKWRAGQPNNFSGNQ-HCV 224
            ||..:|...:  ||....   :|:|:..:.|.|.|..|.:|:.|.|.||:..:    .||: .||
  Fly   140 IRDEQEFNEIFSRAPAGV---FWIDMNAMFKNGLFASSLTGRSPPFFKWKKEE----RGNKFDCV 197

  Fly   225 DLLDGLMYDNKCESLSYFICQSD 247
            ::.:..||:..|.:...||||::
  Fly   198 NVYNKEMYNENCFNTHLFICQAE 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 35/106 (33%)
lectin-30ANP_652635.2 CLECT 118..218 CDD:153057 35/106 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448771
Domainoid 1 1.000 63 1.000 Domainoid score I6773
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.