DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and lectin-46Ca

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster


Alignment Length:147 Identity:34/147 - (23%)
Similarity:63/147 - (42%) Gaps:25/147 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 PKFELIGSRFFYIEDETRRNWTSAGSACRQMGTQLATIRSAEELAALRAKLNKE---RHYWLDIT 187
            |....:..:.||:..: :.||..|.:.|.:.|..||.:.:.|:..|:...:..:   ..:|....
  Fly    35 PYLRELNGKCFYVGIK-KINWFGAQNNCLRKGLNLADVSTMEDFKAVVHYVTSQVGFDDFWFGGN 98

  Fly   188 DLEKEGDFRISASGKRPNFLKWRAG-----QPNNFSGNQHCVDLL----DGLMYDNKCESLSYFI 243
            ||:.||.|:..:|||...::    |     :|...|....|:::.    ..::.|..|:...|||
  Fly    99 DLQSEGRFKYISSGKLVRYM----GDSNIVEPTQRSNLDDCLEIRIRPNVTVVLDVNCQEKKYFI 159

  Fly   244 CQSD--------DDSLD 252
            |:.:        :||.|
  Fly   160 CEQNQMKCAVPAEDSGD 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 27/115 (23%)
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 30/123 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.