DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and Clec4f

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_058031.2 Gene:Clec4f / 51811 MGIID:1859834 Length:548 Species:Mus musculus


Alignment Length:205 Identity:49/205 - (23%)
Similarity:81/205 - (39%) Gaps:41/205 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 HIARHEGEWTSSVLQANATEARLARIETLQTAMNIRQKVLQEGFPKDIVARLDRLESQQAALLRI 115
            ::.|.:.|..|......||:|..|:|:..|.    |...|||.    :.|:....::|...|   
Mouse   356 NLQRAKTEMQSLKADLQATKALTAKIQGEQN----RLGALQEA----VAAQKQEQKTQNQVL--- 409

  Fly   116 LSKFDRKIVAPKFELIGSRFFYIEDETRRNWTSAGSACRQMGTQLATIRSAEELAALRAKLNKER 180
                  :::|..::.....|:|...: ::.|..|...|...|..||::.|.||.|.| .:.....
Mouse   410 ------QLIAQNWKYFNGNFYYFSRD-KKPWREAEKFCTSQGAHLASVTSQEEQAFL-VQTTSSG 466

  Fly   181 HYWLDITDLEKEGDFR-------ISASGKRPNFLKWRAGQPNNF----SGNQHCV-------DLL 227
            .:|:.:||...||.:|       .:|..|  .|  |...||:|:    ...:.||       |:.
Mouse   467 DHWIGLTDQGTEGIWRWVDGTPFNNAQSK--GF--WGKNQPDNWRHRNGEREDCVHVRQQWNDMA 527

  Fly   228 DGLMYDNKCE 237
            .|..|...|:
Mouse   528 CGSSYPWVCK 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 30/115 (26%)
Clec4fNP_058031.2 PhageMin_Tail 144..411 CDD:304511 16/71 (23%)
MscS_porin 222..415 CDD:289559 17/75 (23%)
CLECT_DC-SIGN_like 414..538 CDD:153060 32/130 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.