Sequence 1: | NP_001303306.2 | Gene: | CG15358 / 33366 | FlyBaseID: | FBgn0031373 | Length: | 252 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_058031.2 | Gene: | Clec4f / 51811 | MGIID: | 1859834 | Length: | 548 | Species: | Mus musculus |
Alignment Length: | 205 | Identity: | 49/205 - (23%) |
---|---|---|---|
Similarity: | 81/205 - (39%) | Gaps: | 41/205 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 51 HIARHEGEWTSSVLQANATEARLARIETLQTAMNIRQKVLQEGFPKDIVARLDRLESQQAALLRI 115
Fly 116 LSKFDRKIVAPKFELIGSRFFYIEDETRRNWTSAGSACRQMGTQLATIRSAEELAALRAKLNKER 180
Fly 181 HYWLDITDLEKEGDFR-------ISASGKRPNFLKWRAGQPNNF----SGNQHCV-------DLL 227
Fly 228 DGLMYDNKCE 237 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15358 | NP_001303306.2 | CLECT | 141..245 | CDD:153057 | 30/115 (26%) |
Clec4f | NP_058031.2 | PhageMin_Tail | 144..411 | CDD:304511 | 16/71 (23%) |
MscS_porin | 222..415 | CDD:289559 | 17/75 (23%) | ||
CLECT_DC-SIGN_like | 414..538 | CDD:153060 | 32/130 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR22802 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |