DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and CLEC1B

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001380271.1 Gene:CLEC1B / 51266 HGNCID:24356 Length:229 Species:Homo sapiens


Alignment Length:167 Identity:35/167 - (20%)
Similarity:62/167 - (37%) Gaps:43/167 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 ESQQAALLRILSKFDRKIVAPKFELIG-----------SRFFYIEDET----RRN--WTSAGSAC 153
            |::...|.::..:|.:.:| .:.||.|           :.:.|..|..    |.|  |..:...|
Human    67 ENRTGTLQQLAKRFCQYVV-KQSELKGTFKGHKCSPCDTNWRYYGDSCYGFFRHNLTWEESKQYC 130

  Fly   154 RQMGTQLATIRSAEELAALRAKLNKERHYWLDITDLEKEGDFRISASGKRPNFL-KWRAG---QP 214
            ..|...|..|.:...:..::|:.:..|  |             :..|.::.|.: ||..|   ..
Human   131 TDMNATLLKIDNRNIVEYIKARTHLIR--W-------------VGLSRQKSNEVWKWEDGSVISE 180

  Fly   215 NNF------SGNQHCVDLLDGLMYDNKCESLSYFICQ 245
            |.|      .||.:|....:|.|:...||:..|.:|:
Human   181 NMFEFLEDGKGNMNCAYFHNGKMHPTFCENKHYLMCE 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 25/119 (21%)
CLEC1BNP_001380271.1 ITAM. /evidence=ECO:0000305|PubMed:18215137 7..10
CLECT_NK_receptors_like 102..218 CDD:153063 28/131 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.