DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and CD207

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_056532.4 Gene:CD207 / 50489 HGNCID:17935 Length:328 Species:Homo sapiens


Alignment Length:212 Identity:49/212 - (23%)
Similarity:83/212 - (39%) Gaps:46/212 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 SSVLQANATEARLAR----IETLQ-------------TAMNIRQKVLQEGFPKDIVARLDRLESQ 108
            :||.:|||....|.|    :.||.             :|:|.:.:.||..     :..:.:|..:
Human   128 TSVEKANAQIQILTRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGS-----LENMSKLLKR 187

  Fly   109 QAALLRILSKFDRKIVAPKFELIGSRF----FYIEDETRRNWTSAGSACRQMGTQLATIRSAEEL 169
            |..:|:::|:             |.::    ||......:.|.||...|....:.|.::.|..|.
Human   188 QNDILQVVSQ-------------GWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQ 239

  Fly   170 AALRAKLNKERHYWLDITDLEKEGDFR---ISASGKRPNFLKWRAGQPNNFSGNQHCVDLLDGLM 231
            ..| .|......||:.:|....|||:.   .:...|..:...|..|:|||...|:||.::....:
Human   240 EFL-YKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSVRFWIPGEPNNAGNNEHCGNIKAPSL 303

  Fly   232 Y---DNKCESLSYFICQ 245
            .   |..|:....|||:
Human   304 QAWNDAPCDKTFLFICK 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 28/109 (26%)
CD207NP_056532.4 CLECT_DC-SIGN_like 196..321 CDD:153060 33/139 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.