Sequence 1: | NP_001303306.2 | Gene: | CG15358 / 33366 | FlyBaseID: | FBgn0031373 | Length: | 252 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_056532.4 | Gene: | CD207 / 50489 | HGNCID: | 17935 | Length: | 328 | Species: | Homo sapiens |
Alignment Length: | 212 | Identity: | 49/212 - (23%) |
---|---|---|---|
Similarity: | 83/212 - (39%) | Gaps: | 46/212 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 61 SSVLQANATEARLAR----IETLQ-------------TAMNIRQKVLQEGFPKDIVARLDRLESQ 108
Fly 109 QAALLRILSKFDRKIVAPKFELIGSRF----FYIEDETRRNWTSAGSACRQMGTQLATIRSAEEL 169
Fly 170 AALRAKLNKERHYWLDITDLEKEGDFR---ISASGKRPNFLKWRAGQPNNFSGNQHCVDLLDGLM 231
Fly 232 Y---DNKCESLSYFICQ 245 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15358 | NP_001303306.2 | CLECT | 141..245 | CDD:153057 | 28/109 (26%) |
CD207 | NP_056532.4 | CLECT_DC-SIGN_like | 196..321 | CDD:153060 | 33/139 (24%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 1 | 0.900 | - | - | OOG6_100086 | |
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |