DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and Ly49s5

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001012767.1 Gene:Ly49s5 / 503662 RGDID:1359728 Length:277 Species:Rattus norvegicus


Alignment Length:120 Identity:29/120 - (24%)
Similarity:52/120 - (43%) Gaps:13/120 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 FFYIEDETRRNWTSAGSACRQMGTQLATIRSAEELAALRAKLNKERHYW--LDITDLEKEGDFRI 197
            :::|.|  .|.|......|:........|...:||..|:..:.:: .||  |...:::||..: |
  Rat   153 YYFIMD--IRTWHECKQTCQNYNLSFLKIDDKDELKFLQDHIIRD-SYWVGLSYNNIKKEWSW-I 213

  Fly   198 SASGKRPNFLKWRAGQPNNFSGNQHCVDL-LDGLMYDNKCESLSYFICQSDDDSL 251
            .:|....:.|   |.:|...:|  :|:.. :.||.||: |......||:...|.:
  Rat   214 DSSPLNCDLL---ACKPLQKTG--YCIYFSMTGLHYDD-CGKRHLCICEKGMDKI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 25/106 (24%)
Ly49s5NP_001012767.1 Ly49 38..155 CDD:285577 0/1 (0%)
CLECT_NK_receptors_like 142..257 CDD:153063 28/113 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.