DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and Clec7a

DIOPT Version :10

Sequence 1:NP_608629.3 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001166857.1 Gene:Clec7a / 502902 RGDID:1565140 Length:235 Species:Rattus norvegicus


Alignment Length:114 Identity:27/114 - (23%)
Similarity:52/114 - (45%) Gaps:4/114 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 YIEDETRRNWTSAGSACRQMGTQLATIRSAEELAALRAKLNKER--HYWLDITDLEKEGD-FRIS 198
            |:...:..:|..:...|.|:|..|..|.:|:|...:.::.:..|  .:|:.::..:.||. |...
  Rat   122 YLFSFSENSWYGSRRHCSQLGAHLLKIDNAKEFEFIESQTSSHRVNSFWIGLSRNQSEGPWFWED 186

  Fly   199 ASGKRPNFLKWRAGQPNNFSGNQHCVDLLDGLMYDNKCESLSYFICQSD 247
            .|...||..:.|...|.. |...:||.:....:|:..|.:.|:.||:.:
  Rat   187 GSAFTPNSFQVRNTAPQE-SLPHNCVWIHGSEVYNQMCIASSFTICEKE 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_608629.3 CLECT 141..245 CDD:153057 25/106 (24%)
Clec7aNP_001166857.1 Ly49 34..>63 CDD:462461
CLECT_NK_receptors_like 110..233 CDD:153063 27/111 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.