DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and Clec9a

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001102824.1 Gene:Clec9a / 502901 RGDID:1562513 Length:241 Species:Rattus norvegicus


Alignment Length:157 Identity:42/157 - (26%)
Similarity:61/157 - (38%) Gaps:30/157 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 RLESQQAALLRIL-SKFDRKIVAPKFELIGSRFFYIED--ETRRNWTSAGSACRQMGTQLATIRS 165
            :|:|.||:|.|.| |..:.....|.:...|...:|..|  ||   |.::..:|.:.|..|..|.|
  Rat    92 QLKSCQASLQRSLRSGSNCNPCPPNWIQNGKSCYYAFDRWET---WNNSKKSCLKEGDSLLQIDS 153

  Fly   166 AEELAALRA---KLNKERHYWLDITDLEKEGDFRISASGKRPNFLKWRAGQ---------PNNFS 218
            .||:..:..   ||.....||:        |.|:...||.    ..|..|.         ....|
  Rat   154 KEEMEFINLSIWKLKGGYEYWV--------GVFQDGPSGS----WFWEDGSSPLSDLLPTDRQLS 206

  Fly   219 GNQHCVDLLDGLMYDNKCESLSYFICQ 245
            .:|.|..|.|..:..:.|.:..||||:
  Rat   207 ASQICGYLKDHTLISDNCSNWKYFICE 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 29/115 (25%)
Clec9aNP_001102824.1 ITAM-like 5..10
CLECT_NK_receptors_like 113..234 CDD:153063 34/136 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.