DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and colec10

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001011227.1 Gene:colec10 / 496663 XenbaseID:XB-GENE-945586 Length:275 Species:Xenopus tropicalis


Alignment Length:153 Identity:43/153 - (28%)
Similarity:75/153 - (49%) Gaps:9/153 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 KDIVARLDRLESQQAALLRILSKFDRKIVAPKFELIGSRFFYIEDETRRNWTSAGSACRQMGTQL 160
            :.:|.:||    ...|.|:...||.:.::|...| ...:::||..| .||:..|.:.||..|..|
 Frog   123 RKVVGQLD----VNVAHLKSSLKFVKNVIAGIRE-TDEKYYYIVRE-ERNYRDALTQCRIRGGTL 181

  Fly   161 ATIRSAEELAALRAKLNKERHY--WLDITDLEKEGDFRISASGKRPNFLKWRAGQPNNFSGNQHC 223
            |..:.....:.:...::|...:  ::.|.|:|||..|..:.:.....:..|:||:||:.||.:.|
 Frog   182 AMPKDQATNSLIADYISKMGLFRVFIGINDIEKEKQFVYADNSPLQTYSSWKAGEPNDGSGYEDC 246

  Fly   224 VDLLD-GLMYDNKCESLSYFICQ 245
            |::|. |...|..|....||:|:
 Frog   247 VEMLSTGHWNDVDCSLTIYFVCE 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 31/106 (29%)
colec10NP_001011227.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..76
CLECT_collectin_like 155..270 CDD:153061 34/116 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm72280
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.