DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and colec11

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_009291466.1 Gene:colec11 / 492459 ZFINID:ZDB-GENE-041114-11 Length:277 Species:Danio rerio


Alignment Length:166 Identity:42/166 - (25%)
Similarity:73/166 - (43%) Gaps:28/166 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 AALLRILSKFDRKIVAPKFEL------------------IGSRFFYIEDETRRNWTSAGSACRQM 156
            |.|.:::.:.|.::|....||                  ..|:.:.:..|.:| :..|...|:..
Zfish   116 APLRKMIGEMDIQVVQLTNELKFIKNALPSPAAVAGIKETDSKVYLLVKEEKR-YREAEVFCQGR 179

  Fly   157 GTQLATIRSAEELAALR-----AKLNKERHYWLDITDLEKEGDFRISASGKRPNFLKWRAGQPNN 216
            |..||..:.|....|:.     |.|::   .::.|.|||:||.|..........|.:||.|:|||
Zfish   180 GGHLAMPKDAAANRAIAGYVTDAGLSR---VYIGINDLEREGHFVYVERSPMTTFSRWREGEPNN 241

  Fly   217 FSGNQHCVDLL-DGLMYDNKCESLSYFICQSDDDSL 251
            ...::.||::: .|...|..|:...||:|:.|.|::
Zfish   242 AYDDEDCVEMVSSGEWIDVACQLTMYFVCEFDKDTV 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 32/109 (29%)
colec11XP_009291466.1 Collagen 44..102 CDD:189968
CLECT_collectin_like 157..272 CDD:153061 34/118 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm25445
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.