DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and Clec4a4

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001005860.1 Gene:Clec4a4 / 474145 MGIID:3624119 Length:236 Species:Mus musculus


Alignment Length:96 Identity:22/96 - (22%)
Similarity:34/96 - (35%) Gaps:26/96 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 SRFFYIEDETRRNWTSAGSACRQMGTQLATIRSAEELAALRAKLNKERHY-------------WL 184
            |..::|.::::.:|..:...|..||..|..|.|..|...:.:.||....|             |:
Mouse   116 SHCYFILNDSKASWNESEEKCSHMGAHLVVIHSQAEQDFITSNLNTSAGYFIGLLDAGQRQWRWI 180

  Fly   185 DITDLEKEGDFRISASGKRPNFLKWRAGQPN 215
            |.|...|...|             |..|:||
Mouse   181 DQTPYNKSATF-------------WHKGEPN 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 20/88 (23%)
Clec4a4NP_001005860.1 CLECT_DC-SIGN_like 107..230 CDD:153060 22/96 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X73
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.