DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and Clec4a

DIOPT Version :10

Sequence 1:NP_608629.3 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001005899.2 Gene:Clec4a / 474143 RGDID:1359662 Length:240 Species:Rattus norvegicus


Alignment Length:130 Identity:30/130 - (23%)
Similarity:55/130 - (42%) Gaps:13/130 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 PK-FELIGSRFFYIEDET----RRNWTSAGSACRQMGTQLATIRSAEELAALRAKLNKERHYWLD 185
            || ::..||..:::...|    :.:|..:...|..||..|..|.|.||...:...||::..|::.
  Rat   108 PKNWKPFGSHCYWVTKHTSTYSKASWNESEKNCFSMGAHLLVIHSKEEQDFITGILNRDAAYFIG 172

  Fly   186 ITDLEKEGDFRISASGKRPNFLKWRAGQPNNFSGNQHCVDLLDGL-----MYDNKCESLSYFICQ 245
            :.|........:|.:....:...|..|:|:  |.::.|| :::.|     ..|..|......:||
  Rat   173 LWDSGHRQWQWVSQTPYNASATFWHKGEPS--SDDEKCV-IINHLNSGWGWNDIPCSGKQQSVCQ 234

  Fly   246  245
              Rat   235  234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_608629.3 CLECT 141..245 CDD:153057 24/112 (21%)
Clec4aNP_001005899.2 ITIM motif 5..10
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 18..38
CLECT_DC-SIGN_like 107..235 CDD:153060 30/130 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.