DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and Clec4e

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001005897.2 Gene:Clec4e / 450223 RGDID:1359298 Length:215 Species:Rattus norvegicus


Alignment Length:120 Identity:30/120 - (25%)
Similarity:50/120 - (41%) Gaps:6/120 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 YIEDETRRNWTSAGSACRQMGTQLATIRSAEELAALRAKLNKERHYWLDITDLEKEGDFR-ISAS 200
            |....|...|.|:.:.|..||..|..|.:.||...|.....:::.:::.:||...||.:| :..:
  Rat    93 YFFSTTTLTWPSSLNNCSDMGAHLVVINTWEEQEFLFRTKPRKKEFYIGLTDQVVEGQWRWVDDT 157

  Fly   201 GKRPNFLKWRAGQPNNFSGNQHCVDLLDGLMYDNKCESLSYF-----ICQSDDDS 250
            ....:...|.||:|||....:.|..:.|..........:|.|     ||:..:.|
  Rat   158 PFTESLSFWDAGEPNNIVFVEDCATMRDSSNPRKNWNDVSCFFSMPWICEMPEIS 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 27/109 (25%)
Clec4eNP_001005897.2 CLECT_DC-SIGN_like 81..208 CDD:153060 29/114 (25%)
Confers specificity for glucose/mannose-type carbohydrates. /evidence=ECO:0000250|UniProtKB:Q9ULY5 170..172 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.