DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and Clec4b2

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001005896.2 Gene:Clec4b2 / 450222 RGDID:1359354 Length:208 Species:Rattus norvegicus


Alignment Length:144 Identity:31/144 - (21%)
Similarity:50/144 - (34%) Gaps:41/144 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 PK-FELIGSRFFYIEDETRRNWTSAGSACRQMGTQLATIRSAEELAALRAKLNKERHY------- 182
            || ::..||..::..|.. .||..:...|..||..|..|.|.||...:...|:....|       
  Rat    80 PKDWKSFGSHCYFTTDFV-ANWNESKEKCSHMGAHLLVIHSQEEQDFINGILDTRWGYFTGLSDQ 143

  Fly   183 ------WLDITDLEKEGDFRISASGKRPNFLKWRAGQPNNFSGNQHCVDLLDGLMYDNKCESLSY 241
                  |:|.|...:...|             |...:|||  ..:.||::       |..:.:.:
  Rat   144 GQNQWQWIDQTPYNESVTF-------------WHEDEPNN--DYEKCVEI-------NHHKDIGW 186

  Fly   242 ----FICQSDDDSL 251
                .:|.|:..|:
  Rat   187 GWNDIVCSSEHKSI 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 23/120 (19%)
Clec4b2NP_001005896.2 CLECT_DC-SIGN_like 79..202 CDD:153060 31/144 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.