DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and ASGR1

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001662.1 Gene:ASGR1 / 432 HGNCID:742 Length:291 Species:Homo sapiens


Alignment Length:218 Identity:46/218 - (21%)
Similarity:80/218 - (36%) Gaps:54/218 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 ATEARL-----------ARIETLQTAMNIRQKVLQEGFP------KDIVARLDRLESQQAALLRI 115
            :|||::           .::::|::.:..:||.|.|...      |..|:.|..|..|.|||   
Human    83 STEAQVKGLSTQGGNVGRKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQMAAL--- 144

  Fly   116 LSKFDRKIVAPKFELIGSRFFYIEDETRRNWTSAGSACRQMGTQLATIRSAEELAALRAKLNKER 180
            ......:...|...:...|..|....:.:.|..|.:.||.....|..:.|.||...::..:....
Human   145 QGNGSERTCCPVNWVEHERSCYWFSRSGKAWADADNYCRLEDAHLVVVTSWEEQKFVQHHIGPVN 209

  Fly   181 HY-----------WLDITDLEKEGDFRISASGKRPNFLKWRAGQPNNFSGN--------QHCVDL 226
            .:           |:|.||.|             ..|..||..||:::.|:        .|..| 
Human   210 TWMGLHDQNGPWKWVDGTDYE-------------TGFKNWRPEQPDDWYGHGLGGGEDCAHFTD- 260

  Fly   227 LDGLMYDNKCESLSYFICQSDDD 249
             ||...|:.|:....::|:::.|
Human   261 -DGRWNDDVCQRPYRWVCETELD 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 25/122 (20%)
ASGR1NP_001662.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
Endocytosis signal. /evidence=ECO:0000255 5..8
Lectin_N 17..144 CDD:309178 14/60 (23%)
CLECT_DC-SIGN_like 154..279 CDD:153060 29/139 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.