DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and MBL2

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_000233.1 Gene:MBL2 / 4153 HGNCID:6922 Length:248 Species:Homo sapiens


Alignment Length:140 Identity:37/140 - (26%)
Similarity:69/140 - (49%) Gaps:5/140 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 SQQAALLRILSKFDRKIVAPKFELIGSRFFYIEDETRRNWTSAGSACRQMGTQLATIRSAEELAA 171
            |::.||...:::..:.:.....:.:|::||....|. ..:....:.|.:....:||.|:|.|..|
Human   110 SERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEI-MTFEKVKALCVKFQASVATPRNAAENGA 173

  Fly   172 LRAKLNKERHYWLDITDLEKEGDFRISASGKRPNFLKWRAGQPNNFSGNQHCVDLL-DGLMYDNK 235
            ::..:.:|.  :|.|||.:.||.| :..:|.|..:..|..|:|||...::.||.|| :|...|..
Human   174 IQNLIKEEA--FLGITDEKTEGQF-VDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVP 235

  Fly   236 CESLSYFICQ 245
            |.:....:|:
Human   236 CSTSHLAVCE 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 30/104 (29%)
MBL2NP_000233.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 43..113 1/2 (50%)
CLECT_collectin_like 136..246 CDD:153061 33/114 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I5300
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.