DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and CLEC17A

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001191047.1 Gene:CLEC17A / 388512 HGNCID:34520 Length:378 Species:Homo sapiens


Alignment Length:183 Identity:48/183 - (26%)
Similarity:80/183 - (43%) Gaps:17/183 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 EARLARIETLQTAMNIRQKVLQEGFPKDIVARLDRLESQQAALLRILSKFD-RKIVAPK----FE 129
            |.|:...:.:....|:.......|...|| ||: |.::.| :|:.:....| |:|..|:    ||
Human   201 ELRMLSFQQMTWRTNMTGMAGLAGLKHDI-ARV-RADTNQ-SLVELWGLLDCRRITCPEGWLPFE 262

  Fly   130 LIGSRFFYIEDETRRNWTSAGSACRQMGTQLATIRSAEELAALRAKLNKERHYWLDITDLEKEGD 194
               .:.:|....| ::|..|...|::..:.|..|.|..|...:.......|.|||.:.|..:|||
Human   263 ---GKCYYFSPST-KSWDEARMFCQENYSHLVIINSFAEHNFVAKAHGSPRVYWLGLNDRAQEGD 323

  Fly   195 FR-ISASGKRPNFLKWRAGQPNNFSGNQHCVDL-LDGLMYDNKCESLSYFICQ 245
            :| :..|....:|  |...:|||.. ::.|..: ..|...|..|...:|:||:
Human   324 WRWLDGSPVTLSF--WEPEEPNNIH-DEDCATMNKGGTWNDLSCYKTTYWICE 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 29/105 (28%)
CLEC17ANP_001191047.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..119
CLECT_DC-SIGN_like 254..374 CDD:153060 34/127 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 72 1.000 Domainoid score I9332
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.