DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and Clec4d

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001003707.1 Gene:Clec4d / 362432 RGDID:1303339 Length:218 Species:Rattus norvegicus


Alignment Length:100 Identity:25/100 - (25%)
Similarity:49/100 - (49%) Gaps:8/100 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 FFYIEDETRRNWTSAGSACRQMGTQLATIRSAEELAALRAKLNKERHYWLDITDLEKEGDFR-IS 198
            :|.:.|  .:.|..:...|..|.:.|.||.:..|...:...|:::..|:|.::..:.||.:: :.
  Rat    94 YFALND--NQTWHESERNCSGMSSHLVTINTEAEQDFVTQLLDEQFSYFLGLSYEKVEGQWQWVD 156

  Fly   199 ASGKRPNFLKWRAGQPNNFSGNQHCVDLLDGLMYD 233
            .:...||.:.|:.|:|.: |..:.||    .|:||
  Rat   157 KTPFNPNVVFWKVGEPKD-SMEEDCV----VLVYD 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 22/93 (24%)
Clec4dNP_001003707.1 CLECT_DC-SIGN_like 82..206 CDD:153060 24/99 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.