DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and Clec4a1

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001005890.1 Gene:Clec4a1 / 362430 RGDID:1359109 Length:243 Species:Rattus norvegicus


Alignment Length:163 Identity:39/163 - (23%)
Similarity:70/163 - (42%) Gaps:18/163 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 DIVARLDRLESQQAALLRIL---SKFDRKI--VAPK-FELIGSRFFYIEDETRRNWTSAGSACRQ 155
            |::...:.|:....|.|..:   |..:.|:  ..|| ::..||..::...:: .:|:.:...|..
  Rat    79 DLLEEKNTLQQLNHAKLHCIKNHSSVEDKVWSCCPKNWKPFGSHCYFTSRDS-ASWSDSEEKCSH 142

  Fly   156 MGTQLATIRSAEELAALRAKLNKERHYWLDITDLEKEGDFR-ISASGKRPNFLKWRAGQPNNFSG 219
            .|..|..|.|.||...:...||...||::.::|.|..|.:: :..:....|...|.|.:|   ||
  Rat   143 RGAHLLVIHSQEEQDFITDTLNPRAHYYVGLSDTEGHGKWQWVDQTPFNQNATSWHADEP---SG 204

  Fly   220 NQ-HCVDL-----LDGLMYD-NKCESLSYFICQ 245
            |: .||.|     |.|..:. ..|:.....:|:
  Rat   205 NKGFCVVLSYHPNLKGWGWSVAPCDGYHRLVCK 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 28/111 (25%)
Clec4a1NP_001005890.1 CLECT_DC-SIGN_like 112..238 CDD:153060 33/130 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.