DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and CG7763

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster


Alignment Length:260 Identity:79/260 - (30%)
Similarity:123/260 - (47%) Gaps:48/260 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQKLSIWLLLALFAWNAHAPSAAMPSVCLLQDAPQQCGEFCLTALSPMLDHIARHEGEWTSSVLQ 65
            |||..|:|:|.|...:::  |||...|    ::..||..:|...|:|.:..:..         ||
  Fly     1 MQKSIIFLVLPLCLSSSY--SAACEGV----ESDSQCAAYCYGVLNPCIASMGN---------LQ 50

  Fly    66 ANATEARLARIETLQTAMNIRQKVLQEGFPKDIVARLD--------RLESQQAA--LLRILSKFD 120
                    .|:|..:.|:.|.:..|.:       .|||        :||:|..:  ||...:...
  Fly    51 --------RRVEACEAAVAIARIALND-------RRLDNFGTSTNLQLENQNTSQQLLTHGTAMG 100

  Fly   121 RKIVAPK-FELIGSRFFYIEDETRRNWTSAGSACRQMGTQLATIRSAEELAALRAKLNKERHYWL 184
            ||:...: |:.:||:::|||.|.:.||..|...|.:||..||:::|.|||.....:||....||:
  Fly   101 RKLEENEIFQQLGSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDRFNNQLNGLNRYWI 165

  Fly   185 DITDLEKEGDFRISASGKRPNFLKWRAGQPNNFSGNQHCVDL--LDG--LMYDNKCESLSYFICQ 245
            |:|:...|.:|.....|.:.|||.|..|:|..   :..|||:  .:|  .|.||.|.:..||||:
  Fly   166 DVTNQFNESEFVSVTKGSKANFLSWADGEPTK---DGECVDIRTFNGKTTMNDNSCFANLYFICE 227

  Fly   246  245
              Fly   228  227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 39/107 (36%)
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 43/115 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448809
Domainoid 1 1.000 54 1.000 Domainoid score I11019
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.