DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and Lectin-galC1

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster


Alignment Length:146 Identity:42/146 - (28%)
Similarity:66/146 - (45%) Gaps:19/146 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 FDRKIVAPKFELIGSRFFYIEDETRRNWTSAGSACRQMGTQLATIRSAEELAALRAKL--NKER- 180
            |...:.|..|..|...:::...|: .||..|...||::.::|.|..:.:|..|:.|.|  |..| 
  Fly    34 FGALVKAEPFTKINDGYYFFGTES-LNWYEAYEKCRELNSELVTFETDQEFDAVTAFLTANGSRL 97

  Fly   181 HYWLDITDLEKEGDFRISASGKRPNFLKWRAGQPNNFSGNQHCVDLLDGLMY---------DNKC 236
            .||....||.|.|..|...:.:|.:.|:|...||:|....:||:.|  |.:|         |..|
  Fly    98 TYWTSGNDLAKTGSHRWFTNAQRISSLRWARNQPDNAGQKEHCIHL--GYIYKDSRKFELNDRPC 160

  Fly   237 ----ESLSYFICQSDD 248
                .||..:||::.:
  Fly   161 SQDPNSLFKYICEAPE 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 37/119 (31%)
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 37/124 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448819
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X73
54.950

Return to query results.
Submit another query.