DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and Acp29AB

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster


Alignment Length:255 Identity:74/255 - (29%)
Similarity:111/255 - (43%) Gaps:44/255 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LSIWLLLALFAWNAHAPS--AAMPSVCLLQDAPQQCGEFCLTALSPMLDHIARHEGEW-TSSVLQ 65
            |::|.|..|.......|:  |.:||    ...||.           .:|.|..::..| |.:.|:
  Fly    10 LALWNLWDLSGGQQDIPNGKATLPS----PQTPQN-----------TIDQIGINQNYWFTYNALK 59

  Fly    66 ANATEARLARIETLQTAMNIRQKVLQEGFPKDIVARLDRLESQQAALLRILS-------KFDRKI 123
            .|.|   ||.|:|::  |.|...:|:.....:|          |...|:|:.       |....|
  Fly    60 QNET---LAIIDTME--MRIASSLLEFKAQMEI----------QLQPLKIIMRHHASNIKASNNI 109

  Fly   124 VAPKFELIGSRFFYIEDETRRNWTSAGSACRQMGTQLATIRSAEELAALRAKLNKERHYWLDITD 188
            ...:||.:|||.|:||....:.|..|...||:|...||.|:...||..:.| |.....||:||:.
  Fly   110 KMRRFEKVGSRHFHIEKNLMQTWFEAYVTCRKMNGHLANIQDEMELDGILA-LAPNNSYWIDISK 173

  Fly   189 L-EKEGDFRISASGKRPNFLKWRAGQPNNFSGNQHCVDLLDGLMYDNKCESLSYFICQSD 247
            | |..|.|..:.:|:.|.|:||::.|... ..|| ||.:....|..::|.....|:||:|
  Fly   174 LVENGGTFVSTLTGREPFFVKWKSNQDTK-KKNQ-CVYIYAKEMSYDECFEKKSFVCQAD 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 33/104 (32%)
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 36/110 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448786
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D112956at50557
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.