DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and CG15818

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_609116.1 Gene:CG15818 / 34019 FlyBaseID:FBgn0031910 Length:283 Species:Drosophila melanogaster


Alignment Length:254 Identity:90/254 - (35%)
Similarity:139/254 - (54%) Gaps:33/254 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VCLLQDAPQQCGEFCLTALSPMLDHIARHEGEWTSSVLQANATEARLARIETLQTAMNIRQKVLQ 91
            ||||.|.|.||.|:|::||.|::||:::.:.:|.:..::.|.:.|:|.:||...||..| |...|
  Fly    31 VCLLSDPPNQCSEYCVSALQPVIDHLSKEQQDWGACEVKLNGSVAKLDKIEDQLTATQI-QIEAQ 94

  Fly    92 EGF----------PKDIVARL------------------DRLESQQAALLRILSKFDRKIVAPKF 128
            :.|          .:|:..:|                  .|.|:|..|:.:.||..:||:|..::
  Fly    95 QAFLVNNISKAIKTEDLEQKLKDIEGNQTALSNQLKDGQKRTENQLTAIQKTLSDIERKLVLQRY 159

  Fly   129 ELIGSRFFYIEDETRRNWTSAGSACRQMGTQLATIRSAEELAALRAKLNKERHYWLDITDLEKEG 193
            :.||||:||||...:.||.:|...|.:||..||..::|||..|:..:||| .:|||.:.||.|:|
  Fly   160 QQIGSRYFYIEHNLQVNWRTAEQRCIEMGGHLAAFQNAEEYNAIVGQLNK-ANYWLGVNDLAKQG 223

  Fly   194 DFRISASGKRPNFLKWRAGQPNNFSGNQHCVDLL--DGLMYDNKCES-LSYFICQSDDD 249
            :|...|||||..:.|||..:|...:..|||..:.  :.:|....|.: :.:||||||.|
  Fly   224 EFISLASGKRATYFKWRKNEPKYNNPTQHCAYVFGHENIMIVLSCTTDVMHFICQSDSD 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 39/106 (37%)
CG15818NP_609116.1 CLECT 164..278 CDD:153057 45/114 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448748
Domainoid 1 1.000 63 1.000 Domainoid score I6773
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 1 1.000 - - otm72280
orthoMCL 1 0.900 - - OOG6_100086
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.