DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and lectin-21Cb

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster


Alignment Length:246 Identity:74/246 - (30%)
Similarity:119/246 - (48%) Gaps:33/246 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PSAAMPSVC---LLQDAPQQCGEFCLTALSPMLDHIARHEGEWTSSVLQANATEARLARIETLQT 81
            |..|..:.|   .|.:..::.|||.|....|:|..|.:            |..:..|..||.|..
  Fly    17 PQGAQENNCPKVSLSERLEKRGEFSLVEFDPLLKFIVK------------NPHKELLGEIEGLVG 69

  Fly    82 AMNIRQKVLQEGFPKDIVARLD------RLESQQAALLRILSKF-----DRKIVA-----PKFEL 130
            ....:.:.::...|....|.|:      :||...|||.:.::..     :.|:::     |:|:.
  Fly    70 HTENKLQPMKSVIPNQSKALLNYLDLHSKLEYLDAALQKAINSLQCSLKNTKVMSTGKPHPEFQK 134

  Fly   131 IGSRFFYIEDETRRNWTSAGSACRQMGTQLATIRSAEELAALRAKLNKERHYWLDITDLEKEGDF 195
            :|||:||||...|:||..|...||:||..|||.:..:||..:|.:| :.|.:||||::|..:..:
  Fly   135 LGSRYFYIERHVRQNWFDAADKCRRMGGHLATPQDEDELYLIRKQL-EARWFWLDISNLVDKDQY 198

  Fly   196 RISASGKRPNFLKWRAGQPNNFSGNQHCVDLLDGLMYDNKCESLSYFICQS 246
            ...|:||..::||||.|:|.. |...:|..|..|..|..:|...::||||:
  Fly   199 ISLATGKEVSYLKWRHGEPKK-SSTANCAYLYAGDYYTYQCSDRNFFICQA 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 38/103 (37%)
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 44/111 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448783
Domainoid 1 1.000 63 1.000 Domainoid score I6773
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 1 1.000 - - otm72280
orthoMCL 1 0.900 - - OOG6_100086
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.