DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and CG12111

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster


Alignment Length:130 Identity:40/130 - (30%)
Similarity:65/130 - (50%) Gaps:9/130 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 FELIGSRFFYIEDETRRNWTSAGSACRQMGTQLATIRSAEELAAL----RAKLNKERHY-WLDIT 187
            |..||..::|||...:.||..|..|||.|...||:|....|:.||    :||..|...| |:...
  Fly    48 FVRIGDNYYYIEPMNKVNWFQAAGACRMMNAHLASIEDKPEMEALIKYMKAKGFKNNDYFWISGN 112

  Fly   188 DLEKEGDFRISASGKRPNFLKWRAGQ--PNNFSGNQHCVDLL--DGLMYDNKCESLSYFICQSDD 248
            ||..||.|...::|:...:..|...:  |:|:.||::||.:.  ..::.|..|:....::|::.:
  Fly   113 DLGTEGAFYWMSNGRPMTYAPWNGPKQMPDNYGGNENCVHMFATREMINDANCKIQMLYVCEATE 177

  Fly   249  248
              Fly   178  177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 33/112 (29%)
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 36/118 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448799
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X73
43.850

Return to query results.
Submit another query.