DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and CD209

DIOPT Version :10

Sequence 1:NP_608629.3 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_066978.1 Gene:CD209 / 30835 HGNCID:1641 Length:404 Species:Homo sapiens


Alignment Length:118 Identity:37/118 - (31%)
Similarity:66/118 - (55%) Gaps:8/118 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 FF----YIEDETRRNWTSAGSACRQMGTQLATIRSAEELAALRAKLNKERHY-WLDITDLEKEGD 194
            ||    |....::|||..:.:||:::|.||..|:||||...|:.:.::...: |:.::||.:||.
Human   262 FFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGT 326

  Fly   195 FR-ISASGKRPNFLK-WRAGQPNNFSGNQHCVDLLDGLMYDNKCESLSYFICQ 245
            :: :..|...|:|.: |..|:|||. |.:.|.:.......|:||....::||:
Human   327 WQWVDGSPLLPSFKQYWNRGEPNNV-GEEDCAEFSGNGWNDDKCNLAKFWICK 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_608629.3 CLECT 141..245 CDD:153057 33/106 (31%)
CD209NP_066978.1 Endocytosis signal 14..15
Endocytosis signal. /evidence=ECO:0000255 16..18
Endocytosis signal. /evidence=ECO:0000255 31..34
transmembrane domain 36..59
GumC <53..>225 CDD:442439
neck domain 60..249
CLECT_DC-SIGN_like 256..379 CDD:153060 37/118 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.