DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and Cd209l1

DIOPT Version :10

Sequence 1:NP_608629.3 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_221808.5 Gene:Cd209l1 / 304197 RGDID:1564571 Length:207 Species:Rattus norvegicus


Alignment Length:118 Identity:33/118 - (27%)
Similarity:59/118 - (50%) Gaps:11/118 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 GSRFFYIEDETRRNWTSAGSACRQMGTQLATIRSAEELAALRAKLNKERHYWLDITDLEKEGDFR 196
            |:.:|:  ...::.|..:..||:.||.||..|:|.||.:.|:.....:.:.|:.::|.::| |..
  Rat    89 GNCYFF--STFQKKWKESVIACKDMGAQLVVIKSYEEQSFLQRTSKMKGNTWIGLSDSQEE-DQW 150

  Fly   197 ISASGKRPNFLKWR----AGQPNNFSGNQHCVDLLDGLMYDNKCESLSYFICQ 245
            :...|..   |:||    ||:|||.. ::.||:.......|..|....::||:
  Rat   151 LWVDGSP---LQWRNYWSAGEPNNLY-DEDCVEFSSYGWNDISCSFEKFWICK 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_608629.3 CLECT 141..245 CDD:153057 30/107 (28%)
Cd209l1XP_221808.5 CLECT_DC-SIGN_like 80..200 CDD:153060 33/118 (28%)

Return to query results.
Submit another query.