DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and RGD1564571

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_221808.5 Gene:RGD1564571 / 304197 RGDID:1564571 Length:207 Species:Rattus norvegicus


Alignment Length:118 Identity:33/118 - (27%)
Similarity:59/118 - (50%) Gaps:11/118 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 GSRFFYIEDETRRNWTSAGSACRQMGTQLATIRSAEELAALRAKLNKERHYWLDITDLEKEGDFR 196
            |:.:|:  ...::.|..:..||:.||.||..|:|.||.:.|:.....:.:.|:.::|.::| |..
  Rat    89 GNCYFF--STFQKKWKESVIACKDMGAQLVVIKSYEEQSFLQRTSKMKGNTWIGLSDSQEE-DQW 150

  Fly   197 ISASGKRPNFLKWR----AGQPNNFSGNQHCVDLLDGLMYDNKCESLSYFICQ 245
            :...|..   |:||    ||:|||.. ::.||:.......|..|....::||:
  Rat   151 LWVDGSP---LQWRNYWSAGEPNNLY-DEDCVEFSSYGWNDISCSFEKFWICK 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 30/107 (28%)
RGD1564571XP_221808.5 CLECT_DC-SIGN_like 80..200 CDD:153060 33/118 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 71 1.000 Domainoid score I9193
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.